KEGG   Gramella forsetii: GFO_0700Help
Entry
GFO_0700          CDS       T00448                                 

Gene name
mro
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
gfo  Gramella forsetii
Pathway
gfo00010  Glycolysis / Gluconeogenesis
gfo00052  Galactose metabolism
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
gfo01120  Microbial metabolism in diverse environments
gfo01130  Biosynthesis of antibiotics
Module
gfo_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFO_0700 (mro)
   00052 Galactose metabolism
    GFO_0700 (mro)
Enzymes [BR:gfo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     GFO_0700 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TYA
Motif
Other DBs
NCBI-ProteinID: CAL65677
UniProt: A0LZ82
LinkDB All DBs
Position
776932..778140
Genome map
AA seq 402 aa AA seqDB search
MKKLYKPLRFFCLAFALILIQCKDANKGSDSENLSASEQQEVDKDETKMNIEQSNFGETA
DGKSVEHYTISNASGLEMSVISYGGIITSLKVPNKNGDYENVVLGFDNIKDYEDGSPYFG
AIIGRYGNRIAGGKFTLDGKEYNLDTNDGPNSLHGGEKGFDKVVWDVASSTEGNTATLEL
SYTSKDGEGGFPGNLKTTVTYTLNSDNELDIKYEATTDKKTIVNLTQHSYFNLSGDFSKK
ILDHVVEINADEFLPVDKTLIPTGELKPVKGTPFDFSEPTTIAKGLELEGSNEQLDRGPG
FDHCWVLNGQDSGKRFAASAYEPDSGRFMEVYTNEPALQFYIGNFLDGSLPASGGGTYEK
RTGFCMETQHYPDSPNQENFSSTVLEPEEKYTSETSYKFSVK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactctataaaccgcttcgatttttttgtctggcttttgcactgatcttaatt
caatgtaaggatgccaataaaggaagtgattctgaaaacctttccgcatctgaacagcag
gaagtagataaagatgaaacaaaaatgaatatcgagcaaagcaattttggtgaaactgct
gatggtaaatcggtagaacactatacgatctcaaacgcttcaggacttgaaatgagtgtc
atcagctatggagggatcataacttctctaaaggttcccaataaaaatggcgattacgaa
aatgttgtgctggggtttgataatattaaggattatgaggatggtagtccatattttggt
gcgatcataggtcgttatggcaaccgaatagcaggcggaaaattcaccctggatggtaag
gaatataatcttgataccaatgacggaccaaatagtttgcatggaggagagaaaggattt
gataaagtggtttgggatgttgcatccagcactgaagggaataccgcaaccttggagctc
agctatacaagtaaggatggtgaaggtggatttcctggtaatttaaaaacgacggtgacc
tatacattgaattcagataacgaattagatattaaatacgaagctactaccgataaaaag
acgattgtaaacctaacacaacattcatattttaatctttccggggattttagtaaaaag
atactggatcatgtagtagagatcaatgcagatgaattcctgccagtagataaaacatta
attcctaccggtgaattaaagcctgtgaaaggaactccttttgatttttctgaaccaact
accattgcaaaaggactggagttggaaggttctaatgagcaactggacagaggaccggga
tttgatcattgctgggttttgaacgggcaggatagcggtaaacgtttcgcagcctctgct
tatgagcctgatagcggtagatttatggaagtttataccaatgagccggcacttcagttc
tatatcgggaatttcctggatggaagtcttcctgcatcgggcggagggacctatgaaaaa
cgtactggattctgtatggaaacacaacattatccggattcaccaaatcaggaaaatttc
tcttcgacagtactagaaccggaagagaaatatacttcagaaacttcttataaattttca
gtaaaataa

DBGET integrated database retrieval system