KEGG   Gramella forsetii: GFO_1487Help
Entry
GFO_1487          CDS       T00448                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gfo  Gramella forsetii
Pathway
gfo00620  Pyruvate metabolism
gfo00680  Methane metabolism
gfo01100  Metabolic pathways
gfo01120  Microbial metabolism in diverse environments
gfo01200  Carbon metabolism
Module
gfo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GFO_1487 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    GFO_1487 (ppc)
Enzymes [BR:gfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GFO_1487 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: CAL66460
UniProt: A0M1G5
LinkDB All DBs
Position
1537882..1540455
Genome map
AA seq 857 aa AA seqDB search
MHREPRLDRFNDNVLAKYQVYNSIFLTLPYSDIRKTGALLPLFQEICETGFNNNENPSQI
VDLFFEKYGENPSEEEKVDLLFRFIQYIERQVVLFDAIEDASFSIVNNMDGRGTLRSVKE
EAEAKQKVGELKDYLKRFNVRPTLTAHPTQFYPGTVLGIITDLDKAIQKNDLVKIRQLLA
QLGKTPFFKKEKPTPYDEAVNLIWYFENVFYQSASKIHNYIQQNIFDGEDIGNQVVNLGF
WPGGDRDGNPFVTTEITLRVAKRLRRTILLNYYRDIRKLKRRLTFREVHELMTEIEKGLY
DSAISKSGSIKLTLEDFKSKLLKIKSILIEKHQSLFIEEVDDMLNKVHLFGYHFATLDIR
QDSSIHEEVLAEISKLNPELIPSNYNDLNDDEQIKILSNVKGKLDPEEMEEGMMKATISS
MFAMQEIQEKSGELGANRYIISNCGSVQGVLQPFAFLKMTGWEKPSVDVVPLFETVPDLQ
DAHNVMEKLYTNPVYKDHLKRRGNKQTIMLGFSDGTKDGGYLMANWSIYKAKESLTKISR
EYGIKVVFFDGRGGPPARGGGKTHQFYASLGPTIENEEIHLTVQGQTISSNFGTKDSCTY
NLEQLLSSGVSNEIFSNGKNVLKDDDRKTMTELAEISYETYTNFKKHPRFIPYLEKMSTL
KYYAKTNIGSRPSKRNQSAELNLSDLRAIPFVGSWSQLKQNVPGFFGVGTAMEKLEKNGE
FAKVKQLYDNSEFFRTLLENSMMSLTKSFFPLTAYMKNDEEFGEFWQLIHEEFERTKKML
LKVTGYNVLMQNQPAGRASIQARERIVLPLLTIQQHALRQVQELSKNPENAGKELETFEK
MVTRSLYGNINASRNSA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgcacagagaaccaagattagatagatttaatgataacgtgctcgcaaaataccaggtt
tataatagtatatttttaaccctgccatatagtgatattagaaagacgggtgcacttttg
ccgttatttcaggaaatttgtgaaaccggctttaataataatgaaaatccttcacaaatc
gtagatctctttttcgaaaagtacggtgaaaatccttcagaagaagagaaagtagatctc
ctttttagatttattcagtatatagaaagacaggttgtattgtttgatgcgatagaagac
gcttcattttctatagttaataatatggatgggcgtggtacacttcgaagtgttaaagaa
gaggctgaagcgaaacagaaagtaggtgagttgaaagattatctgaaaaggtttaatgtt
agaccaacgcttacggcacatccaacacaattttatccaggaacggtactaggtattatt
acagatttagataaggcgattcaaaagaatgatcttgtcaaaattaggcagctgctagct
caattgggtaaaacgccattttttaaaaaggaaaaaccaactccttatgacgaggcagtt
aaccttatctggtattttgaaaacgtattctatcaaagtgccagtaagattcataattat
attcaacagaatatttttgacggagaagatatagggaatcaagttgtaaatctagggttc
tggcccggaggtgaccgtgacgggaatccttttgtgactactgaaataaccctgagagtt
gctaaaagattgagaagaactattctgcttaattactatcgtgatattcgaaaattaaaa
aggagactcacttttagagaggttcatgagttaatgactgaaatcgaaaagggactttat
gattcagcgatctctaaatctggaagtattaaacttacgcttgaagactttaaatctaaa
cttcttaagatcaaaagtatacttatagaaaagcatcagtctttatttattgaggaagta
gatgatatgcttaataaagtacatttgtttgggtatcattttgcaactttagatatccgt
caggattccagtattcatgaagaagttttagctgaaatcagtaagctaaatcctgaactt
attccttcaaattacaacgatctaaatgatgatgagcaaataaagattcttagcaatgtt
aaggggaagcttgatcctgaagaaatggaagaaggaatgatgaaagcaacaatttcttca
atgtttgccatgcaggagattcaggagaaaagtggagaacttggcgctaatcgttatatt
attagtaactgtggaagtgttcagggagtgcttcagccatttgcatttttaaaaatgact
ggatgggagaaaccaagtgtagacgtagttcctctatttgaaaccgtacccgatcttcag
gatgcgcataatgtgatggagaagctttatacaaatcccgtgtataaagatcatttgaaa
agaagaggtaacaaacaaacgatcatgcttgggtttagtgacggaactaaagatggtggt
tatttgatggcaaactggagtatttataaagcgaaagaatctctgactaaaatttcacgg
gaatatgggattaaagtagttttctttgatggtagaggaggaccaccggcaagaggtggc
ggtaaaacgcatcagttctatgcttctctaggtccaaccatagaaaatgaggaaattcac
ctaacagttcaggggcaaacgattagttcaaattttggaactaaagattcatgtacttat
aaccttgagcagttattaagttctggtgtttctaatgaaattttcagcaatggcaagaat
gttctgaaagatgatgacaggaagacgatgacagaacttgccgaaataagctatgaaact
tatacaaactttaagaaacatcccaggtttataccttatcttgagaagatgagtactttg
aagtattatgccaaaactaatattgggagtaggccttcaaagcgtaaccaatctgcagaa
ttaaatctttcagatcttcgagcaataccatttgtgggtagttggagccagttaaaacaa
aatgttcccggattttttggtgtgggaactgccatggaaaaactggagaaaaatggtgag
tttgctaaggtgaaacagctttacgacaattcagaattttttagaactctgctggaaaat
agtatgatgagccttaccaaatcattctttcctttaacggcttatatgaagaatgatgaa
gaatttggagaattctggcaattgatccatgaagagtttgaacgtactaagaaaatgcta
ttgaaggtgacgggatataatgttttaatgcaaaaccaacctgcgggaagggcatctatc
caggctcgtgagagaattgttctgcctttacttaccattcagcagcatgcgttaagacag
gtgcaggaattaagtaaaaatcctgaaaacgcaggaaaagagctggaaacttttgaaaag
atggtaactcgctcgctttatgggaatattaatgcaagtagaaattcagcataa

DBGET integrated database retrieval system