KEGG   Gramella forsetii: GFO_3083Help
Entry
GFO_3083          CDS       T00448                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
gfo  Gramella forsetii
Pathway
gfo00020  Citrate cycle (TCA cycle)
gfo00310  Lysine degradation
gfo00380  Tryptophan metabolism
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
gfo01120  Microbial metabolism in diverse environments
gfo01130  Biosynthesis of antibiotics
gfo01200  Carbon metabolism
Module
gfo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gfo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GFO_3083 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    GFO_3083 (sucA)
   00380 Tryptophan metabolism
    GFO_3083 (sucA)
Enzymes [BR:gfo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GFO_3083 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: CAL68027
UniProt: A0M5Y2
LinkDB All DBs
Position
complement(3237635..3240415)
Genome map
AA seq 926 aa AA seqDB search
MDRFSFLNAAHTAYFAELYDQYLKHPDSVEPSWRAFFQGFDFGMQENGISEEVLGEAPVD
FAEGDIPAHVIKEFQVIRLIDGYRTRGHLFTKTNPVRERRKYEPTLEISNFGLEESDLQT
TFNAGDILGIGPTTLKEIVRHLENIYCESIGIEYMYIRKPEELQWIQDKLNVNENHPEFD
DAQKKQILKKLNEAVSFESFLHTKYVGQKRFSLEGGESLIPGLDAIIEKAAEFGVEEFVM
GMAHRGRLNTLTNIFGKSAKDIFSEFDGKDYEQDIFDGDVKYHLGWTSCRKTDSGKGINI
NIAPNPSHLETVGAVVEGITRAKQDRRYKGDNSKVLPILVHGDAAIAGQGIAYEIVQMAQ
LEGYETGGTIHIVVNNQIGFTTNYLDARSSTYCTDVGKVTLSPVLHVNSDDAEAVVHAML
FALDFRMKFKRDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAISKHENARDIYFEKLKKQG
VADDEYLKELEDTYKAALEENLEDSRKEETTRITPFMAEEWEGFESAQEDEMMKDVDTTF
DLDRLDKVAEAVSQLPEGKKFMRKIKKIIDGRKKMYFEDNKLDWSMAEHLAYGSLMAEGY
NIRISGQDSERGTFSHRHAVVKVEDSEEEIILHNNIEERDGDFFIYNSPLSEYGVVGFDY
GYSMASPTTLNIWEAQFGDFVNGAQIVIDQYISAAEDKWKLQNGLVMLLPHGYEGQGAEH
SSGRMERFLQLCAKDNMYVADVSTPANMFHILRRQMKAKFRKPLIIFTPKSLLRHSKVIS
TKEEFATGSFQPVIDDHDANIEKIKTLVFCTGKFYYDLLKHREENEREDVALVRIEQLFP
LPISKMKELMDTYKNADDVVWAQEEPRNMGAYSHLLLHFEEARKFRVCSRKFYGSPAAGS
SVRFKKRHERVINSVFDKNLNEEENN
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggatagattttcatttctaaatgctgctcatactgcatatttcgcagaactttacgat
caatatctaaaacatcctgatagtgtggagcccagttggagggcttttttccagggattt
gactttggaatgcaagaaaacggcatttcagaagaagtattgggagaggctcctgtagat
tttgcagaaggagatataccagcacacgtaattaaagaatttcaggtaatacgcttaatt
gacggttacagaacccgagggcatttgtttaccaaaacaaatcctgtaagagaacgcagg
aagtacgagccgacgctggagatttccaactttggtcttgaagaaagcgacctgcaaaca
actttcaatgccggggatatacttgggattgggcctactactttaaaagaaatcgttagg
catcttgagaatatttactgtgaatctattgggatcgagtatatgtatattcgtaagcct
gaagagttacagtggatacaggataagctgaacgttaatgagaatcatccagaatttgac
gatgctcagaagaaacaaatactaaagaaacttaacgaagcagtttcctttgaatctttt
cttcataccaaatatgttgggcaaaaacgtttttcactggaaggtggagagagcctaatt
cccggacttgatgctataattgagaaagcagcggaatttggtgtggaagaatttgtgatg
gggatggcccaccgtggaagattaaataccctcacgaatatcttcggaaaaagtgctaaa
gatatttttagtgaatttgacggaaaagattacgaacaggatatttttgatggagacgta
aaatatcacctgggatggacttcctgtcgaaaaaccgatagtggaaaaggaataaatata
aatattgctcccaacccttctcacctggaaacggtaggagcggtagtagaggggattacc
cgtgcgaaacaggatcgtcgttacaagggtgataattctaaagtactgccaatcctggtg
catggtgatgcagctattgccggacagggaatagcttatgaaatagtgcaaatggcccag
ctggaaggttatgaaaccggtggaaccattcatattgtagtaaataaccagattggattt
acaacaaattatctggatgccagaagttcaacctattgtacagatgttgggaaagtaacc
ctttccccggtacttcatgtaaattcagatgatgctgaagctgtggtacatgccatgctt
tttgcattggatttcaggatgaagtttaagcgggacgtattcattgaccttcttggttac
agaaaatacgggcataatgaaggggacgagccaagatttactcagcctaaactttataaa
gctatctccaagcatgaaaatgctcgggatatttattttgagaagctgaaaaaacaagga
gtcgcagacgatgaatatctaaaagaattagaagatacttataaagcggcactggaagaa
aacctggaagattcccgaaaagaagaaacaaccagaattacgccatttatggcagaggag
tgggaaggctttgaaagtgcccaggaagatgaaatgatgaaggatgtggataccacattc
gatcttgacaggctggataaagttgcagaagctgtttctcaattgccggaagggaaaaag
tttatgagaaagattaagaagatcatagacggcagaaaaaaaatgtactttgaagataat
aagttagactggtctatggcagaacatctggcttatggatctttgatggctgaaggatat
aatattagaattagcgggcaggatagtgaaaggggtacattttcacaccgtcatgcggta
gtaaaggtagaagacagtgaagaagagatcattcttcataataacatagaagaaagagac
ggagatttctttatctataattctccactttcagaatatggagttgttggttttgattat
ggatattccatggcaagtccaactacgcttaatatatgggaagctcagttcggagatttt
gtgaatggagctcagattgtaatagatcaatatatatcagcggccgaagataaatggaaa
cttcaaaacggtctggtgatgttattgcctcatggttacgaaggtcagggagcagaacac
tcttcaggaagaatggagcgttttcttcaactttgtgctaaagataatatgtatgtagca
gatgtttctacacctgccaatatgttccatattctaagaagacaaatgaaggctaagttt
agaaagcctttgatcatctttaccccgaaaagtttattaagacattcaaaagtgatctct
accaaagaggagtttgctacaggaagttttcagcctgtaatagatgatcatgatgctaat
attgaaaagataaaaacactggtattctgtacaggtaaattctattatgatcttctaaaa
catagagaagagaatgaaagagaagatgtggcacttgttaggatagaacagttatttcca
ttaccaatttcaaaaatgaaagagttgatggatacatataaaaatgctgatgatgtagtg
tgggcgcaagaagaaccacgtaatatgggagcttacagtcacttactattacattttgaa
gaagcacgaaaattcagggtctgcagtcgtaaattttacgggtcacctgctgccggtagt
tctgtgcgtttcaagaaacgtcacgaacgtgtgatcaacagtgtttttgataagaattta
aacgaagaagaaaataattaa

DBGET integrated database retrieval system