KEGG   Gramella forsetii: GFO_3354Help
Entry
GFO_3354          CDS       T00448                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
gfo  Gramella forsetii
Pathway
gfo00240  Pyrimidine metabolism
gfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    GFO_3354 (tdk)
Enzymes [BR:gfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GFO_3354 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: CAL68295
UniProt: A0M6Q0
LinkDB All DBs
Position
complement(3516971..3517618)
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNHEEQFGWIEVICGSMFSGKTEELIRRLKRAKFAKQNVEIFKPAIDTRYDEEM
VVSHDSNEIRSTPVPSASNIRLLADGCDVVGIDEAQFFDDEIVTVCNDLANRGVRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQFSYRKAINDDLVFLGENEEYEP
LSRAAYYKAMLRERVRKLDVNDAEELNQKAKEENA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcacgaagagcaatttggctggattgaggtaatttgc
ggctcgatgttttccggaaaaacggaagaactcatccgtagactcaagcgtgcgaaattt
gctaaacagaatgtagagatctttaaacctgctatagatactcgttatgacgaggaaatg
gtggtgtctcacgattctaatgaaatacgttccaccccggttccttcagcttcaaatatc
agattattagcagatggatgtgacgtagtaggaattgatgaagcccagttttttgatgat
gagatagtcacggtatgtaatgatcttgccaataggggcgttcgggttattgtagcagga
cttgacatggattttaaaggaaatcccttcgggccgatgccaaatttaatggccactgca
gagtatgttaccaaagtgcacgcggtatgtacccgaaccgggaatcttgctcagttcagc
tataggaaagctataaacgacgatctggtatttctaggagagaatgaagaatatgaaccg
ctaagtcgggcggcctattataaagctatgcttagagaaagggttaggaaactggatgta
aacgatgcggaagaattgaatcaaaaagccaaagaggaaaatgcctga

DBGET integrated database retrieval system