KEGG   Geospiza fortis (medium ground-finch): 102031420
Entry
102031420         CDS       T03755                                 

Gene name
MDM4
Definition
(RefSeq) MDM4, p53 regulator
  KO
K10127  protein Mdm4
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102031420 (MDM4)
Ubiquitin system [BR:gfr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102031420 (MDM4)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB
Other DBs
NCBI-GeneID: 102031420
NCBI-ProteinID: XP_005430835
UniProt: A0A6I9HVH2
LinkDB
Position
Un
AA seq 470 aa
MSFPNSTQPPGAGNSCRITLGQANQVVPKLPLLRILQAAGAQGDSFTLKEVMHFLGQYIM
ARQLYDKRQQHLVHCGGDQLGELLGLQSFSVKDPSPVYEMLKRNLSPAALPDAAQTLPKE
QSVAKPSPDQLQLSQEEGSDSGILEGDSKTSAPATSEPKCDTCEDSDLIENLSKSKKPKL
DLVFEEWDVAGLPWWFLGNLRSNYKSRSNGSTDIQTNQDIDTAIVSDTTDDLWFLNECPL
EQGAAGLKVEVLDCEEVTEGDTKVPEDVCLDELEDSQRLSDDTDTEAASEDCWQCSKCRK
FNSPGKRYCFRCWALRKDWYRDCPKLPHSLSLSNINSMENQEQDEGMDVPDCRRTISAPA
GQPKHVFLGANKPRVDPGGSVESLDLAQEGKNRDFAKLKKEEEVESLESIKTLLNPCFLC
QHRPRDGNIVHGRTAHLVACFRCARMLKKKRSPCPVCRKEIKMVIRIFMG
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgagcttcccaaattccacccaacctccaggagctgggaattcctgcaggatcaccctg
ggccaagccaatcaggtggttcccaagctgcccctgctgaggatcctgcaggctgcgggg
gcccagggtgactccttcacgctcaaagaggtgatgcatttcctgggccagtacatcatg
gcccggcagctctacgacaagaggcagcagcacctggtgcactgtggtggagatcagctg
ggagagctgctgggactgcagagcttctctgtcaaggaccccagccccgtgtacgagatg
ctgaagaggaacctgagccctgctgccctcccagatgctgcacagactctcccaaaggag
cagagcgtcgctaagcccagcccagaccagctgcagctcagccaggaggaaggatctgac
tctgggatcctggagggtgacagcaaaacctcagctcctgctacctcagagcccaaatgt
gacacttgtgaagacagtgatttgatagaaaacctctccaaaagcaaaaagcccaagctg
gacctggtttttgaggaatgggatgtggctgggctgccgtggtggtttttagggaatctc
agaagcaattacaaatccaggagtaacggatccacggatattcagactaaccaggacatt
gacactgccatagtttcagacaccactgatgacctgtggttcctcaacgagtgtcccctg
gagcagggcgctgctgggctcaaggtggaagtgctggactgtgaggaggtcacagaaggt
gacaccaaggtgcctgaggatgtgtgcttggatgagctggaggattcccagcgcctgagc
gacgacacggacacagaggctgcttctgaggattgctggcaatgctccaagtgcaggaaa
ttcaactctccgggtaaaaggtactgcttccgctgctgggccctgcgcaaggactggtac
agggactgccccaaactgccccattccctgtccctctccaacatcaattccatggaaaac
caggagcaggacgaagggatggacgtcccagactgcaggaggacgatctcagccccggct
ggccaacccaaacacgttttcctgggagcaaacaaaccccgcgtggatcccggcggctcc
gtcgagtccttggatttggcgcaggaggggaaaaatcgggattttgccaagctgaagaaa
gaggaggaggtggaatctttggagagcatcaaaaccctgctgaatccctgcttcctgtgc
cagcacaggcctcgggatgggaatattgtccacggaaggactgctcacctggtggcctgc
ttcaggtgtgccaggatgctgaagaagaagagatcgccgtgtcccgtgtgcaggaaggag
atcaagatggtcatcaggatcttcatggggtag

DBGET integrated database retrieval system