KEGG   Geospiza fortis (medium ground-finch): 102031518
Entry
102031518         CDS       T03755                                 

Gene name
AIFM2
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 2
  KO
K22745  apoptosis-inducing factor 2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102031518 (AIFM2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox K_oxygenase NAD_binding_9 DAO GIDA HI0933_like Lycopene_cycl Thi4 Trp_halogenase DUF4147 DUF2748 StbA Peptidase_S28
Other DBs
NCBI-GeneID: 102031518
NCBI-ProteinID: XP_005429019
UniProt: A0A6I9HRP9
LinkDB
Position
Un
AA seq 354 aa
FGGTAAASLLKSWAVPFVLVDVRDAFHHNVAALRAAVESGFAKKTFISYSVTFGDSFRQG
KVVAIDPGRQQVVLSDGEELHYSHLILATGSDGPFPGKFNQVIDMESAIQTYEDMVKEIE
KSQRILVVGGGAAGVEMAAEIKTEYPDKEVTLIHSKTALADVELLPSVRQVVKEILLRKG
VRLLLGEKVSDIENLRPNQFQKDMVVRTERGTEVVVDMVVLCTGIKINSSAYAAAFGDKM
ASNGALKVNKHLQVEGYENIYAIGDCADLKEPKMAYHAGLHANIVVTNIINSLTQKPLKT
YEPGSLIFLLFMGRNDGVGXXXGYYVGRLLVTIAKSRDLFVSKSWKNMGQTMPS
NT seq 1065 nt   +upstreamnt  +downstreamnt
ttcggagggacggcggccgccagcctgctcaagtcctgggccgtccccttcgtgctggtg
gacgtgagagatgctttccatcacaacgtggccgcgctccgggccgccgtggagagcgga
tttgccaagaagactttcatctcctactcggtcacctttggggacagcttccgacaaggc
aaggtggtggcgatagaccctgggaggcaacaagtggtgctcagtgatggtgaggagctt
cactactcccatctcattcttgcaacaggcagtgatgggccattccctgggaagttcaac
caagtcattgacatggagagtgccatccagacctatgaagacatggttaaagagattgag
aaatctcagcgcatcctggtagtgggaggtggtgctgctggagtggagatggctgccgag
atcaaaacggagtacccagacaaagaggtcactctcattcactcaaaaactgcactggct
gacgtggagctgctgcccagtgtccgtcaggtggtgaaagagattctcctcaggaaagga
gtccggctgctgttaggtgaaaaagtcagtgacatagaaaacctcaggccaaaccagttc
cagaaggacatggtagtgaggacagagaggggcactgaagtggttgttgacatggtggtg
ctgtgcacggggataaagattaactcttctgcatatgctgctgcatttggtgacaaaatg
gcaagtaatggtgctttgaaagttaacaagcatctccaggtggaaggctacgagaacatc
tatgccattggggactgtgcagatctcaaagagcccaagatggcctaccatgctgggctc
catgccaacattgtggtgacaaatatcatcaacagcctgacacagaagcctctcaaaacc
tatgagccagggtcactaatattcctgcttttcatgggcaggaatgatggtgtgggnnnn
nnnnnnggttactatgtgggacgtctcctggtgaccattgccaagagccgggatctgttt
gtctccaagagctggaagaacatggggcagacaatgccctcctga

DBGET integrated database retrieval system