KEGG   Geospiza fortis (medium ground-finch): 102031762
Entry
102031762         CDS       T03755                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04145  Phagosome
gfr04350  TGF-beta signaling pathway
gfr04510  Focal adhesion
gfr04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102031762 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102031762 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102031762 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102031762 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102031762 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gfr04131]
    102031762 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gfr00536]
    102031762 (THBS1)
   04990 Domain-containing proteins not elsewhere classified [BR:gfr04990]
    102031762 (THBS1)
Membrane trafficking [BR:gfr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    102031762 (THBS1)
Glycosaminoglycan binding proteins [BR:gfr00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   102031762 (THBS1)
Domain-containing proteins not elsewhere classified [BR:gfr04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   102031762 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA TSP1_ADAMTS cEGF Laminin_G_3 TSP1_CCN EGF Laminin_G_2
Other DBs
NCBI-GeneID: 102031762
NCBI-ProteinID: XP_014166272
UniProt: A0A6I9ZDQ2
LinkDB
Position
Un
AA seq 1211 aa
MGPATALCLLLLVLGGSETKRTAESRNDDNSVFDLFELIGFMKKGAGRRAPGVYLVKGPE
SSSPAYRIEDASRIPAVPDSKFQDLLDAIHAEKGFILLATLRQAKKSRGTLLSVEQKDGS
GHVFSLVSNGKAGSLDLSLSADGKQQLVSVEDVLLATGHWKNITLFVQEDRAQLYVGCEK
MENAELDIPIQNIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTLETILRNKGCS
SSTSAIITLDNPINGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTL
QDRVRKVTEENEIIAKVVQITPGACIHNGVLHKNKEEWTIDSCTECTCQNSATICRKVSC
PLMPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRC
EGSSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGIITRIRLCNSPVPQLNGKP
CEGEARENKACQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKTCVG
EARGTQVCNKQDCPIDGCLSNPCFAGATCTSAPDGSWKCGACPAGYHGDGIHCQDIDECK
EVPDACFVFNGVHRCENTEPGYNCLPCPPRFTGTQPFGRSVEDAMSNKQVCKPRNPCTDG
THDCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHC
KKDNCPNLPNSGQEDYDKDGIGDACDSDDDDDGIPDDRDNCPFIYNPQQYDYDRDDVGDR
CDNCPYNHNPDQTDTDNNGEGDACAIDIDGDGVLNERDNCQYVYNVDQRDTDLDGVGDQC
DNCPLEHNPDQEDTDSDLIGDQCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDA
CDHDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENVEIS
ETDFRKFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFF
INTERDDDYAGFVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTTGPG
EHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMA
DSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRGKNDTAFKRSYINELVQEHKSQEGK
LNCDLSWFRFK
NT seq 3636 nt   +upstreamnt  +downstreamnt
atggggccagcgactgctctctgcctccttctcctcgtgctcggcggctcagagaccaag
cgtactgcagagtcccggaatgatgataacagcgtcttcgatctctttgaactcattggc
ttcatgaagaagggagctgggcgccgggcccctggggtgtacctggtgaagggaccagaa
tcctccagccctgcttaccgcattgaagatgccagtcgcatccctgctgtccctgactcc
aagttccaagacttattagatgccattcatgctgagaaaggcttcattctcctggccact
ctccggcaagccaagaagagcagaggcacattgctctccgtggaacagaaagatggctct
ggtcatgtcttcagtctagtatcaaatggcaaggcaggctccctggacctcagcctttct
gctgatggcaagcagcagttagtgtcagtagaggatgtcttgctagctacaggacattgg
aagaatatcaccctgtttgtgcaggaggaccgagctcagctctatgtggggtgtgagaaa
atggagaacgctgaactggacatccccatccagaacatcttcactagggacctcgccagc
agtgccaggctccgtattgccaaaggaggagtcaatgacaacttccagggtctgctgcag
aatgtgcggtttgtgtttggaacaactctggaaactatcttgcggaacaaaggctgctcc
agctccactagtgcaatcattactttggacaaccccatcaatggttccagcccagctatc
cgcactaattacattggccataaaacaaaggacatccaagcagtctgtggattttcctgt
gatgaactaacaaatatgtttgtggaactgcaagggctgcggtccatggttacaacactt
caagacagagtccgaaaagtgactgaagaaaatgaaatcattgccaaagtagtccagatc
actcctggagcgtgcattcataatggagtcttgcacaaaaataaagaggagtggactatt
gacagctgcactgaatgtacttgccagaactctgccactatatgccggaaagtgtcctgt
cctctcatgccttgttccaatgccaccgtgcctgatggggagtgctgccctcggtgctgg
cctagcgactatgcagatgatggatggtctccttggtctgaatggacctcgtgttctgtg
acctgtggtaatgggattcagcagagaggccgttcctgtgacagtctcaacaaccgctgt
gaaggctcctctgtacagactaggacttgccaccttcaggagtgtgataagagatttaaa
caggatggtggctggagtcactggtcgccatggtcatcatgctctgtcacttgtggcacg
ggcatcattactagaattcgtctttgcaactctccagtaccacagctgaatggcaaacct
tgtgagggtgaagcaagagaaaacaaagcctgccagaaagatccttgcccaattaatggc
aactggggaccatggtctccatgggatgcttgcacagtgacatgtggaggaggacttcag
aagcgaagccgtctctgcaataatcccgagcctcagtatggtgggaagacttgtgtaggt
gaagctagagggactcaggtctgcaacaaacaggactgtccaattgatgggtgtctgtct
aatccctgctttgcgggggctacgtgcaccagtgcccctgatggttcctggaagtgtggt
gcctgtcctgctggctaccatggtgatggtattcactgccaagacattgatgagtgcaaa
gaggttcctgatgcctgctttgtcttcaatggagtgcacaggtgtgagaatactgaacct
gggtacaactgtctgccctgcccaccacgtttcactggaacacagccatttggccgcagt
gttgaggatgccatgagtaacaaacaggtctgcaagccacgtaatccatgcacagatgga
acacatgactgtaacaagaatgccaaatgcaattaccttggccactttagtgaccccatg
tatcgctgtgaatgtaaaccaggctatgctggcaacggcatcatctgcggagaagatact
gacttggatggatggccaaatgagaacctggtttgtgttgccaatgctacttaccactgt
aaaaaagataactgccctaatctgcctaactcagggcaggaagactatgataaggatggg
attggtgatgcctgtgacagtgatgatgatgatgatggcattcctgatgaccgggacaac
tgtccattcatctacaacccacagcagtatgactatgacagggatgatgttggtgaccgc
tgtgacaactgtccctacaatcacaaccctgatcaaactgacactgacaacaatggagaa
ggagatgcatgtgcaatagatattgatggagatggggtgcttaatgaaagggacaactgc
cagtatgtctacaatgtagaccagagggatacagacttggatggtgttggagatcagtgt
gataactgtccactggaacacaaccctgaccaggaagataccgattctgacctcataggt
gatcaatgtgacaacaaccaggacatagatgaagatggtcatcaaaataaccttgataac
tgcccctatgtgcccaatgccaatcaagctgaccatgacaaggatggaaaaggtgatgcc
tgtgaccatgatgatgacaatgatggtatccctgatgacaaagacaactgcagattggtt
gccaacccagatcaagctgattctgatggtgatggacgtggagatgcttgcaaagatgac
tttgaccaagacagcgtgccagacattgatgatatctgccctgaaaatgtggaaattagt
gagactgatttccgaaaatttcagatgattcccctggatcccaaaggaacatcccagaat
gatccaaactgggttgttcgtcaccagggtaaagaactggttcagacagtcaactgtgac
cctggccttgcagtcggttttgatgaattcaatgctgtggacttcagtggtaccttcttt
atcaatacagaaagggatgatgattatgctggctttgtatttggctaccaatctagcagt
cgtttctatgttgtcatgtggaagcagatcacccagtcttactgggactccacaccaacc
aaagctcaaggctattcaggtctctccatcaaagttgtgaattccaccactggtccagga
gaacaccttcgtaatgctctgtggcacacaggaaacactcctggccaggtgagaactttg
tggcatgatcctcgtcacataggctggaaagacttcactgcatacaggtggcgacttagc
catagaccaaagaccggctacatcagggttgtaatgtatgaagggaagaaaatcatggca
gactcaggaccaatctacgataaaacctatgctggtggtcggctaggattatttgtcttc
tctcaagaaatggtgttcttctcagaccttaaatatgaatgcagaggtaagaatgacact
gcatttaagagatcctatataaacgaattggttcaagaacataagagccaagagggaaag
ttgaactgtgatctttcgtggttcaggttcaaatga

DBGET integrated database retrieval system