KEGG   Geospiza fortis (medium ground-finch): 102031783
Entry
102031783         CDS       T03755                                 

Gene name
PRKAA2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04140  Autophagy - animal
gfr04150  mTOR signaling pathway
gfr04371  Apelin signaling pathway
gfr04530  Tight junction
gfr04910  Insulin signaling pathway
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102031783 (PRKAA2)
   04068 FoxO signaling pathway
    102031783 (PRKAA2)
   04150 mTOR signaling pathway
    102031783 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102031783 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102031783 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102031783 (PRKAA2)
   04920 Adipocytokine signaling pathway
    102031783 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102031783 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gfr04131]
    102031783 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:gfr03029]
    102031783 (PRKAA2)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102031783 (PRKAA2)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102031783 (PRKAA2)
Membrane trafficking [BR:gfr04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102031783 (PRKAA2)
Mitochondrial biogenesis [BR:gfr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102031783 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    102031783 (PRKAA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 102031783
NCBI-ProteinID: XP_014163290
LinkDB
Position
Un
AA seq 552 aa
MGDREKCWALSLLIPQQQEDTCKVKRRKNLPVGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEAEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKEELPSYLFPEDPSYDATVIDDEAVREVCEKF
ECTESEVMNSLYSGDPQDQLAGAYHLVIDNRRIMNQASEFYLASSPPTGSFMDDSALHIP
PGVKPHPERMPPLIADSPKARCPLDALNTTKPKPLTVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYQVDNRSYLLDFKSIDDEVMEQR
SGSSTPQRSCSAAGLHRPRLSIDAAAATECQSLMGSLSGSFVGSIPSVPPRLGSHTMDFF
EMCASLIMALAR
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgggtgacagggagaaatgctgggcactctccctcctcatcccacagcagcaggaagac
acctgcaaggtgaagaggaggaaaaatctcccagttggtgagcaccagctgacggggcac
aaagtggcagtgaaaatactgaacaggcagaaaatccgcagcctggatgtggtggggaag
atcaagcgggaaatccaaaacctgaaactcttccggcacccccacattatcaaactgtac
caggtcatcagcacaccaacagacttcttcatggtcatggaatacgtgtccgggggggaa
ttgtttgattacatctgtaagcacggacgtgtcgaggaggcagaagcccgacgccttttc
cagcagatcctgtctgcagtggattactgccacaggcacatggtggtgcacagggacctg
aagccagagaacgtgctgctggatgcacacatgaatgcaaagatagctgattttggactg
tccaacatgatgtcagatggtgaatttctacgcaccagctgtggttccccaaattatgca
gcccctgaagtcatctctggaaggctctatgctggcccagaggtggacatctggagctgt
ggtgtgatcctctacgccctcctgtgtggcactctgccttttgatgatgagcacgtcccc
accttgttcaagaagatccgtgggggagtgttttacatccctgaatacctcaaccgctcc
gtggccacgctcctcatgcacatgctgcaggtggaccccctcaagagagccaccatcaag
gacatcagggaacacgagtggttcaaggaggagctgcccagctacctgttcccagaggac
ccttcctacgacgccacggtcatcgacgacgaggcggtgcgcgaggtgtgcgagaagttc
gagtgcaccgagtcggaggtgatgaacagcctgtacagcggcgacccccaggaccagctg
gccggggcctaccacctggtcatcgacaaccgccgcatcatgaaccaggccagcgagttc
tacctggcctccagcccccccacgggctccttcatggacgacagcgccctgcacatcccg
ccgggcgtgaagccgcaccccgagcggatgccgccgctcatcgccgacagccccaaggcc
cgctgccccctggacgccctcaacaccaccaagccaaagcccctgactgtcaaaaaggcc
aagtggcacctgggcatccgcagccagagcaagccctatgacattatggccgaggtgtac
cgggctatgaagcagctggacttcgagtggaaggtggtgaacgcctaccacctgcgggtg
cgccgcaagaaccccgtcaccggcaactacgtgaagatgagcctgcagctctaccaggtg
gacaaccgcagctatctgctggacttcaaaagcatcgatgacgaggtgatggagcagagg
tctggctcctccacgccccagcgctcctgctcggctgcgggcttgcaccggccgcgcctg
agcatcgacgcggccgcggccaccgagtgccagtctctgatgggctccctgagcggctcc
ttcgtgggcagcatcccctcggtgccccctcgcctgggcagccacaccatggacttcttt
gagatgtgtgccagcctcatcatggccctggcccgctga

KEGG   Geospiza fortis (medium ground-finch): 102033868
Entry
102033868         CDS       T03755                                 

Gene name
PRKAG1
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04371  Apelin signaling pathway
gfr04530  Tight junction
gfr04910  Insulin signaling pathway
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102033868 (PRKAG1)
   04068 FoxO signaling pathway
    102033868 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102033868 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102033868 (PRKAG1)
   04920 Adipocytokine signaling pathway
    102033868 (PRKAG1)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 102033868
NCBI-ProteinID: XP_014166366
LinkDB
Position
Un
AA seq 277 aa
MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFI
NILHRYYKSPMVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHR
LPVIDPDSGNTLYILTHKRILKFLKLFISEVPKPEFMARTLEELQIGTYRNIAVVGTSTP
IYVALGIFVQHRVSALPVVDDSGRVVDIYSKFDVINISAQFAEGSRQPRPVAVMDDAHSL
SVVLYLPGPLPTPGLGGTSPTAPANSSIGDAAVKVPW
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaatcccatcgctgctacgacctgatccccaccagctccaaactggtcgtcttcgac
acatccctgcaggtgaagaaggcgttcttcgcgctggtcaccaacggtgtccgggcagcc
ccgctctgggacagcaaaaagcaaagttttgtaggaatgctgaccatcaccgacttcatc
aacatcctgcaccgctactacaaatcccccatggtgcagatttatgagctggaggagcat
aaaatagagacgtggagagaggtttacctgcaagactccttcaagccactggtgtgcatt
tcccccaatgccagcctgtttgacgccgtctcctccctgatccggaacaagatccatcgc
ctgcccgtcatcgaccccgactcggggaacacgctctacatcctcacccacaagcgcatc
ctcaagttcctcaagctctttatctcagaggtgcccaagcctgagttcatggcacggacc
ttggaggagctgcagattggcacctacaggaacattgccgtggttggcaccagcaccccc
atctacgttgccctgggcatcttcgtgcagcaccgcgtctctgccctgcccgtggtggat
gactccgggcgtgtggtggacatctactccaaattcgatgttattaacatctcggcacag
tttgccgaggggagccgtcagccccggccggtagcggtgatggacgatgctcattccctg
tctgtcgtcttgtacctcccggggccgctcccaactcccggcctcggcggcaccagcccg
accgccccggcaaattccagcatcggagatgctgcagtcaaggtgccatggtga

KEGG   Geospiza fortis (medium ground-finch): 102035320
Entry
102035320         CDS       T03755                                 

Gene name
PRKAG3
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04371  Apelin signaling pathway
gfr04530  Tight junction
gfr04910  Insulin signaling pathway
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102035320 (PRKAG3)
   04068 FoxO signaling pathway
    102035320 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102035320 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102035320 (PRKAG3)
   04920 Adipocytokine signaling pathway
    102035320 (PRKAG3)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 102035320
NCBI-ProteinID: XP_005415845
LinkDB
Position
Un
AA seq 305 aa
MHFLRSHCCYDAIPTSCKLVVFDISLEIKKAFLALVANGVRAAPLWDSKTQSFVGMLTIT
DFINILHRYYRSPLVQIYEVEEHKIETWREVYLQGSLKPLVYISPDNSLFDAVYSLIKHK
IHRLPVIEPVSGNVLHILTHKRILKFLHIFASTIPKPRFLKKTVQELCIGTFRDLAVVAE
SAPVHTALEIFVDRRVSALPVINDAGQVVGLYSRFDVIHLAAQKTYNNLDISVREALRQR
SVCLEGVLTFYPHEPMEDIIDRIAKEQVHRLVLVDENRYPRGIVSLSDILQALVLTPAGI
DALNS
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcactttttgaggagccactgctgctatgatgccatccccaccagctgcaagctcgtt
gtctttgacatctccctggagatcaagaaagcctttttggcactggtggccaacggggtt
cgtgctgcccctctctgggacagcaagacgcagagctttgtggggatgctcaccatcacc
gacttcatcaacatcctccaccgctactaccgctcacctttggtgcagatctacgaggtg
gaggagcacaagattgagacctggagagaggtgtacctgcagggctccctcaagccactg
gtctacatctctccggacaatagcctcttcgatgctgtctactccctgatcaagcacaag
atccaccgcctgcctgtcattgagcctgtctcgggcaatgtcctgcacatcctgacgcac
aagcgcatcctcaagttcctccacatctttgcttctaccatccccaagccacgcttcctg
aagaaaacagtgcaggaactgtgcattggcaccttccgtgatctggccgtcgtggctgag
tctgccccagtccacactgccctggagatttttgtggatcgccgtgtctccgccttgcct
gtcatcaatgatgctgggcaggtggttggcctgtactcgcggtttgatgtcattcacctg
gcagcccagaagacctacaacaacctggacatcagtgtgagggaggcgctgcggcagcgc
agtgtctgcctggagggggtcctcaccttctacccccacgaacccatggaggacataatt
gaccgcattgccaaggagcaggtccatcgcctggttctggtggatgagaaccgctacccg
cggggcattgtctccctctctgacatcctgcaggcccttgtgctcactcctgcaggtatt
gatgctcttaactcttag

KEGG   Geospiza fortis (medium ground-finch): 102038682
Entry
102038682         CDS       T03755                                 

Gene name
PRKAA1
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04140  Autophagy - animal
gfr04150  mTOR signaling pathway
gfr04371  Apelin signaling pathway
gfr04530  Tight junction
gfr04910  Insulin signaling pathway
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102038682 (PRKAA1)
   04068 FoxO signaling pathway
    102038682 (PRKAA1)
   04150 mTOR signaling pathway
    102038682 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102038682 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102038682 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102038682 (PRKAA1)
   04920 Adipocytokine signaling pathway
    102038682 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102038682 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gfr04131]
    102038682 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:gfr03029]
    102038682 (PRKAA1)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102038682 (PRKAA1)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102038682 (PRKAA1)
Membrane trafficking [BR:gfr04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102038682 (PRKAA1)
Mitochondrial biogenesis [BR:gfr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102038682 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    102038682 (PRKAA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 102038682
NCBI-ProteinID: XP_005426147
LinkDB
Position
Un
AA seq 548 aa
MGQQCALAARKPESQPHLELYPEQCGQQVKQIGKHELTGHKVAVKILNRQKIRSLDVVGK
IRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGRLDEKESRRLF
QQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPS
VISLLKHMLQVDPMKRATIRDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKF
ECTEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLSRPH
PERVPFLVAEAPRPRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPNDIMAEVCRAIKQL
DYEWKVVNPYYLRVRRKNPVTSAYSKMSLQLYQVDSRTYLLDFRSIDDEIAEAKSGTATP
QRSGSVSNYKSCQKDSDADAQGKSADTSLTSSVNSSLDSSTADVTPRPGSHTIEFFEMCA
NLIKILAQ
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgggccagcaatgtgcacttgcagcccggaaaccagaaagccaaccacatctggagctg
tatccagagcagtgtggccagcaggtcaagcaaattggaaaacatgagctaactgggcat
aaggttgctgtgaagatcctgaatcgacagaagattcgcagccttgatgttgtaggcaaa
atccgcagggagatccagaacctcaaactcttcaggcatcctcatataattaagctgtac
caggtcatcagtacacccactgacattttcatggtgatggaatatgtttcaggaggagaa
ctgtttgattatatctgtaaaaatggaaggcttgatgagaaggaaagtagacgtctgttt
cagcaaatcctttctggtgtggattactgtcacaggcacatggtagtgcatagagatctg
aagcctgaaaatgtgcttcttgatgcccacatgaatgctaagatagctgactttggtcta
tcaaatatgatgtcagatggagaatttttaagaacgagctgtggttcccctaactatgct
gcaccagaagtaatttctggaaggttatatgcaggtccagaagtagatatttggagcagt
ggggttattctctatgctttgttatgcggaacacttccatttgatgatgatcatgtgcca
accctttttaagaagatatgtgatggtatcttttatacccctcagtacctgaatccatct
gtaattagtcttttgaagcacatgctgcaagtggatccaatgaaaagagcaacaatcaga
gacattagggaacatgaatggtttaagcaggatcttccaaaatacttgtttcctgaagat
ccatcatatagctctaccatgattgatgatgaagccttaaaagaagtgtgtgagaagttt
gagtgcacagaagaggaagtgctaagttgtctgtacagccgaaatcatcaggaccctctg
gctgttgcttatcacctcattatagataacagaagaataatgaatgaggccaaagacttc
tacttggccacaagtccaccagattcttttctggatgatcaccacctgtctcgccctcac
cctgaacgagtgccatttttagtagctgaagcaccacgtcctcgccacacccttgatgag
ctgaatccacagaagtcaaagcatcaaggtgtaaggcgggctaaatggcacctggggata
cggagtcagagtcgaccaaatgatatcatggctgaagtttgtagagcaattaaacaactg
gattatgaatggaaggttgtaaatccatactatctgcgtgttcggaggaagaatccagta
acaagtgcatattccaaaatgagtctccagttgtaccaggtggacagcagaacatactta
ctggacttccgtagtattgatgatgaaattgctgaagcgaagtctgggactgcaactcca
cagagatcaggttctgtgagcaactataaatcttgtcaaaaagattcagatgctgatgct
caaggaaaatctgcggatacatcccttacctcatcagtcaactcttcgcttgactcttcc
acagctgatgtaactccaagaccagggagtcatacaattgagttttttgagatgtgtgca
aatcttattaaaatacttgcacagtaa

KEGG   Geospiza fortis (medium ground-finch): 102039548
Entry
102039548         CDS       T03755                                 

Gene name
PRKAB2
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit beta 2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04371  Apelin signaling pathway
gfr04530  Tight junction
gfr04910  Insulin signaling pathway
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102039548 (PRKAB2)
   04068 FoxO signaling pathway
    102039548 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102039548 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102039548 (PRKAB2)
   04920 Adipocytokine signaling pathway
    102039548 (PRKAB2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 102039548
NCBI-ProteinID: XP_005426739
UniProt: A0A6I9HNK9
LinkDB
Position
Un
AA seq 274 aa
MGNTTSERVSGERHGSKSQRSDGSGASHPAKEHPHKIMVGSTDDPSVFSSHDSKIPGDKE
FVSWQPDLEESVKPSQQARPTVIRWADGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDL
PEGEHQYKFFVDGQWVHDPSEPVVTSQMGTINNLIHVKKSDFEVFDALKVDSLESSETSG
RDLSSSPPGPYGQEMYVYRPEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVML
NHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 825 nt   +upstreamnt  +downstreamnt
atggggaacaccaccagcgagcgggtgtcaggggagcgccatggctccaagtcccagcgc
tccgacggctccggtgcctcccaccccgccaaggagcacccgcacaagatcatggtgggc
agcaccgacgaccccagcgtcttcagctcccacgactccaagatccctggggacaaggag
tttgtgtcgtggcagccagatctggaggagtcagtgaaaccatcccaacaggctcgtcca
acggtcatacgctgggctgatggaggcaaggaggtcttcatctccggatccttcaacaac
tggagcaccaagatcccactcatcaagagccacaatgactttgtcgctatcctggacctt
ccagaaggagagcaccagtacaaattttttgtggatggccagtgggttcacgatccatct
gagcctgtggttaccagccagatggggacgataaacaacctcatccatgtcaagaagtct
gactttgaggtgtttgatgcgttgaaggtggattccttggaaagctcagaaacctcaggt
cgggatttatccagctccccaccgggaccttacggccaggagatgtacgtgtaccggccc
gaggagcgcttcaaatccccgcccatcctcccgccccacctcctccaggtcatcctcaac
aaggacaccaacatctcgtgtgacccagccctgctgcctgagcccaaccacgtcatgctc
aatcacctctacgcgctctccatcaaggatggcgtgatggtgctcagtgccacgcaccgc
tacaagaagaagtacgtcaccacgctgctgtacaagcccatctga

KEGG   Geospiza fortis (medium ground-finch): 102042687
Entry
102042687         CDS       T03755                                 

Gene name
PRKAG2
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04371  Apelin signaling pathway
gfr04530  Tight junction
gfr04910  Insulin signaling pathway
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102042687 (PRKAG2)
   04068 FoxO signaling pathway
    102042687 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102042687 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102042687 (PRKAG2)
   04920 Adipocytokine signaling pathway
    102042687 (PRKAG2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 102042687
NCBI-ProteinID: XP_005424403
UniProt: A0A6I9HMW1
LinkDB
Position
Un
AA seq 569 aa
MGSTAMDKKKDASSSSSSRKSSSRKKLMLRVHIPDLSSFAMPFLDGDVDSTDKNAPRKVD
ESYSAGSPSKGLFSKGLQNRPSSPVSAPVRSKHSPGSPKTVFPFPYQESPPRSPRRMSFS
GIFRSSSKESSPNSNPSTSPGGIKFFSRSRKTSGLSSSPSTPTQVTKQPTFPLESYKHEP
ERPETRIHCSSPPDTGQRFSLPPSQSAAKPPIMTPAPCATSKPVSKACPVPSWLPSVQDK
MLEKLEIEVNKALEESESDIYVRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG
VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP
LVNISPDASLFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFMSEMPKPAF
MKKNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN
LAAEKTYNNLDITVTQALQHRSQYFEGVVKCSMLETLETIVDRIVKAEVHRLVVVNEADS
IVGIISLSDILQALVLTPAGAKQKGNESE
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgggaagcactgccatggacaagaagaaagatgcctccagcagcagcagcagcaggaaa
agctccagccgcaagaaactcatgttgcgagtgcacatccccgatctcagctcatttgcc
atgccattcctggacggtgatgtggacagcacagacaaaaatgctcctcgcaaggtggat
gaaagctactcagctggcagtccttccaaaggccttttctccaaggggctccagaaccga
ccttccagccccgtttctgcccctgtgagatccaagcacagtcctggctcacccaaaaca
gtgttccccttcccctaccaggagtctcccccacgctccccacgccgaatgagcttcagt
ggcatcttcaggtcctcctccaaagagtcttcccccaattctaacccgtctacctctcct
gggggcatcaagtttttctccagatcaagaaaaacctctggcctctcctcttctccatct
accccaacacaagtgaccaagcagcccacgtttcctctggaatcctacaagcatgagcct
gagagaccagaaacaagaattcactgttcctcacctccagacacagggcagagattttct
ctgcctccatcacaaagtgcagccaagcctcccatcatgacaccagctccctgtgctacc
tcaaaacctgtaagtaaagcttgtcctgtccctagctggctgccctcagtgcaagataag
atgttggaaaaactcgagattgaagtaaataaggcacttgaagaatcggaaagtgacatt
tatgtgcgattcatgaggtcacacaagtgttatgacattgttccaacaagctctaagctt
gttgttttcgacactacgctacaagtaaagaaagccttttttgccttggtggcaaacggt
gtgagagcagctccactgtgggagagtaaaaaacagagttttgtaggaatgttaacaatt
acagatttcattaacatactgcatagatactataaatctcctatggttcagatttatgaa
ttggaggagcacaagatagaaacctggagggagctttatttacaagagacttttaaacct
ttagtgaacatctccccagatgcaagcctttttgatgctgtatattcgttgatcaaaaac
aaaatccacagattgccagttatagatccagtcagtggaaatgcactttatatacttacc
cataaaagaatcctcaagttcctccagctttttatgtcagagatgccaaagcctgccttt
atgaagaagaatctggatgaacttggaataggaacttatcacaacattgccttcatacat
ccagacactcctatcattaaagccttgaatatatttgtagagcgaaggatatcggcgttg
cctgtggtggatgagtcaggaaaagttgtagatatttattccaaatttgatgtaataaat
cttgctgctgaaaaaacatataataacttagatatcacagtgacacaagccctgcagcac
cgctctcagtattttgaaggtgttgtaaagtgcagtatgctggaaacactggagaccatt
gtggatagaatagtgaaggctgaggttcatcgtttggtggtggtgaatgaagctgatagc
attgtggggatcatctccctctctgacatcctacaagctctggtactcacacctgcaggt
gccaaacaaaaggggaacgagagcgaatga

KEGG   Geospiza fortis (medium ground-finch): 102044941
Entry
102044941         CDS       T03755                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04140  Autophagy - animal
gfr04150  mTOR signaling pathway
gfr04371  Apelin signaling pathway
gfr04530  Tight junction
gfr04910  Insulin signaling pathway
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102044941
   04068 FoxO signaling pathway
    102044941
   04150 mTOR signaling pathway
    102044941
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102044941
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102044941
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102044941
   04920 Adipocytokine signaling pathway
    102044941
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102044941
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gfr04131]
    102044941
   03029 Mitochondrial biogenesis [BR:gfr03029]
    102044941
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102044941
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102044941
Membrane trafficking [BR:gfr04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102044941
Mitochondrial biogenesis [BR:gfr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102044941
  Mitophagy factors
   Other mitophagy factors
    102044941
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 102044941
NCBI-ProteinID: XP_005431363
UniProt: A0A6I9HVD1
LinkDB
Position
Un
AA seq 515 aa
GKHELTGHKVTVKILNRQKIRSLDVVGKIHREIQNLKLFRHPHIIKLYQVISTPTDIFMV
MEYVSGGELFDYICKNGRLDEKESRCLFQQILSGVDYCHRHVVVHRDLKPENVLLDAHMN
AKIADFGKYMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLP
FDDDHVPTLFKKICDGIFYTPQYLNPPVSSLLKHMLQVDPIKRATIRNIREHEWFKQDLP
KYLFPEDPSYSSTMIDDEALKEVCEKFECTEEEVLSCLYSQNHQDPLVVAYHLIIDNRRI
MNEAKDFYLATSPLDFFLDDHNLSRPHPERVPFLVAEAPRPRHTLDELNPQKSKHQGVRR
AKWHLGIRSQSRPNDIMSEVCRAIKQLDYEWKVVNPYYLRVRSKNPVTSAYSKMSLQLYL
VDSRMYLLDFRSIDDEITEAKSGTATPQRSGSVSNCRSCQKDSDGDAQGKSEDMSLTPSA
TSLIDSSKAELTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1550 nt   +upstreamnt  +downstreamnt
ttggtaaacatgaattaactgggcataaagtcacagtgaagatcctaaatcgacagaaga
ttcgcagccttgatgttgtaggaaaaatccacagggagatccagaacctcaaactcttca
gacatcctcatataattaaactgtaccaggtcatcagtacgccaactgacattttcatgg
tgatggaatatgtttcaggaggagaactgtttgattatatctgtaaaaatggaaggcttg
atgaaaaggaaagtagatgtctgttccagcaaatcctttctggtgtggattactgtcaca
ggcatgtggtagtacatagagatctgaagcctgaaaatgtgctgcttgatgcacacatga
atgccaagatagctgattttggtaagtatatgatgtcagatggagaatttttaagaacaa
gctgtggttcccctaactatgctgcaccagaagtaatttcaggaagattatatgcaggtc
cagaagtagatatttggagcagtggggttattctctatgctttgttatgcggaacacttc
catttgatgatgatcatgtgccaaccctttttaagaagatatgtgatggtatcttttata
cccctcaatacctgaatccacctgtatctagtcttctgaaacacatgctgcaagtagatc
caattaagagagcaacaatcagaaacattagagaacatgaatggtttaagcaggaccttc
ccaagtacctgtttcctgaagacccatcatatagttctaccatgattgatgatgaagcct
taaaagaagtgtgtgagaagtttgaatgcactgaagaagaagtgctaagttgtctgtaca
gccaaaatcatcaggaccctttagtggttgcttatcacctcattatagataataggagaa
taatgaatgaggccaaagacttctacttggctacaagcccactggatttttttcttgatg
atcacaatctgtctcgacctcatcctgaaagagtgccattcttagtagctgaagcaccac
gtccccgccatactcttgatgagctgaatccacagaagtcaaaacaccaaggtgtaagaa
gagccaagtggcacttgggaatacggagtcagagtagaccaaatgatatcatgtctgaag
tttgtcgagcaattaaacaactggattatgaatggaaggttgtaaatccatactatctgc
gtgttcgaagcaagaatccagtgacaagtgcatattccaaaatgagtctacagttgtatc
tggtggatagcagaatgtacttactggacttccgtagcattgatgatgaaattactgaag
caaaatctgggactgcaactccacagagatcaggttctgtgagtaactgtagatcctgtc
aaaaagattcagatggtgatgcacagggaaaatctgaagatatgtcccttacaccatcag
caacctctttgattgattcttctaaggctgaattaactccaaggccaggaagtcatacaa
tagaattctttgagatgtgtgcaaatcttattaaaatacttgcacaataa

KEGG   Geospiza fortis (medium ground-finch): 102045511
Entry
102045511         CDS       T03755                                 

Gene name
PRKAB1
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit beta 1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04371  Apelin signaling pathway
gfr04530  Tight junction
gfr04910  Insulin signaling pathway
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102045511 (PRKAB1)
   04068 FoxO signaling pathway
    102045511 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102045511 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102045511 (PRKAB1)
   04920 Adipocytokine signaling pathway
    102045511 (PRKAB1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 102045511
NCBI-ProteinID: XP_005421533
UniProt: A0A6I9HJ00
LinkDB
Position
Un
AA seq 271 aa
MGNTSSERAGLERHGHKATRGDSSGGATKEGDRPKILMDSPEDADLFHPEEMKAPLEKEE
FLAWQQDLEVNDKTPTQARPTVFRWTGGGKEVYLSGSFNNWSKIPLTRSHNNFVAILDLP
EGEHQYKFLVDGQWTHDPAEPVVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSEL
SSSPPGPYHQEPYVCKAEERFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHL
YALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 816 nt   +upstreamnt  +downstreamnt
atggggaacacgagcagcgagcgcgcggggctggagcgccatgggcacaaagccacccga
ggggacagctcaggaggagccaccaaggagggggacaggcccaaaatcctcatggacagc
cctgaagatgcagacttgttccatccagaggaaatgaaggctccactggagaaagaagag
tttctagcttggcagcaggacctggaggtgaatgacaaaacccccactcaagctcggcct
acggtgttccgctggactggaggagggaaggaggtttatttgtcaggctccttcaacaac
tggagtaaaattcctctgactaggagtcacaataactttgtggcaatcctggacctgcca
gaaggagagcaccagtacaagttcctcgtggatgggcagtggacacacgatccggcagag
ccagtagtaaccagccagctgggtactgtcaacaacatcatccaggtgaagaaaactgac
tttgaagtgttcgatgctttgatggtggactcccaaaaatgttcagacgtgtctgagctg
tccagttcacccccaggaccgtaccaccaggagccctatgtctgcaaggcagaggagcga
tttaaatccccacccattctccccccacacctgttgcaggtcatcctgaacaaggacaca
ggcatttcttgtgaccccgctctgctccctgagcccaaccacgtcatgttgaaccacctg
tatgcactttccatcaaggatggagtgatggtgctcagtgctacacaccgttacaagaag
aaatacgtgaccactttgctgtacaagccaatatga

DBGET integrated database retrieval system