KEGG   Geospiza fortis (medium ground-finch): 102031837Help
Entry
102031837         CDS       T03755                                 

Gene name
ERCC5
Definition
(RefSeq) ERCC excision repair 5, endonuclease
  KO
K10846  DNA excision repair protein ERCC-5
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    102031837 (ERCC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gfr03400]
    102031837 (ERCC5)
DNA repair and recombination proteins [BR:gfr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     102031837 (ERCC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 102031837
NCBI-ProteinID: XP_005422728
LinkDB All DBs
Position
Un
AA seq 1193 aa AA seqDB search
MGVQGLWKLLECTGRPINPETLEGKILAVDISIWLNQAIKGARDRGGISVRNAHLLTLFH
RLCKLLFFRIRPVFVFDGEAPLLKRQTLAKRRQRKEIAINDSRKTTEKLLKTLLKRHVIK
TAITGKSNEALPSITQVRRQGIDDMYVLPTLEDEEKHSSEEEEEKEWQMRMSQKQMLQEQ
LCENPYSIDIESEDFHKLPPEIKHEILTDIKELTKRRRTLFEAMPEDSNDFSQYQLRGLL
KKSNLNRCIENVQKEMNQQHSGEIQTQYENEGGFVKEVESRRVVSEETSHYILIKGIQAK
EAMNRDLETTAGPSSKMHELPKLNKINESPANAKLSVSDKKQTEEDDSVVAAPPSPRTLL
AIQAAMVESSSEEELDTGQLSVDQFVSEEGSVSPRTLRAIQQALSEDDKGEEVVTATTGG
VLSERPEGKDFLLCSSDEEEQIPKVEGKNIPIATIHSSIQVTMQDAKFKQKSQELEKSGI
TPKDTVIFKDENYSAIENTRKGKEDVDEENDLEKHIAPKDASISRAETYIDNTIKDTEDV
DREENGSKNHISPNDTCISRAENYSYVNNTRKDKEDLDKEKNGSKMDLKSLGEKDMSLCL
QKPSCSPEQTNIDALIHTETTDLSKNEKNLKVSENTQAVNSQTEENVSEDIRLFPEARDP
EVEREGISQSEDSDSDGSFIEVDAEVSNEAESPTKYDEKVGDEPTLAEVESDRPDAFTVD
LQKESDEVQLRNTQNIEGEADGKAAVDEWQDISLEELEELEKNLSAEQSTLQSQKQQQER
VAASVTGQMFLESQELLRLFGIPYIEAPMEAEAQCAILDLTDQTSGTITDDSDVWLFGAR
HVYKNFFSQNKYVEYYQYVDFQNELGLDRNKLINLAYLLGSDYTEGIPNVGFVTAMEILN
EFPGHGLEPLLKFAEWWNEAQKNKKVMPNPHDTKVKKKLRELQLYSGFPNPAVAEAYLKP
VVDESRGSFIWGKPDVEQIREFCKDHFGWTRTKIDGILLPVMKQLNLQQTQLRIDSFFRL
EQHEKQAIKSQRLRRAVTCLKRKGKEEADDEIQEATAVMEMELKQPGKRKGEGTTGYANQ
AAATKVQSGKRRKQSDSRKEFLYGGGFVGNLHLSETSSDSSVEESKGRDLGKSKRRKNMS
ATETADHKEKKGCSSSSGEDEDLGNVVMVTAKPVFEGRKKKSRSKRGIRKKMS
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcaaggactttggaagctgcttgaatgcaccgggagacccataaacccagaa
acgctggaagggaaaattcttgctgttgatatcagtatttggttgaaccaagcaataaag
ggagccagagatcgtggtggcatttctgtacggaatgctcacctgctcactctgtttcat
cggctctgcaagttactgtttttccggattcgacccgtctttgtttttgatggagaagcg
cctcttctgaagagacaaaccttggccaagcgaagacaaagaaaggaaattgctatcaat
gattccaggaaaactacagagaaactcttgaaaacacttttgaagagacatgttatcaaa
actgctattacaggcaaaagcaatgaagctttgcccagtattacacaagttcgaagacaa
ggaattgatgatatgtatgtattgcctactttagaggatgaagagaagcatagctcagag
gaggaggaagaaaaggaatggcaaatgagaatgagccaaaaacagatgttgcaagaacag
ttatgtgaaaatccttattctatagatattgaatcagaagatttccacaagcttcctcca
gaaataaaacatgagatcttgactgatattaaagaacttacaaagcgaagaagaacgtta
tttgaagcaatgccagaggactccaatgacttttcccagtaccagcttaggggtttgctt
aaaaaaagcaacctcaatcggtgcatagaaaatgtacaaaaagaaatgaatcaacagcac
tcgggtgaaatccaaacacaatatgaaaatgaaggtggttttgtgaaagaagtggaatca
aggagagtggtctctgaagagacttctcactatattctgataaagggtattcaagcaaaa
gaggctatgaatagagacttggaaactactgcaggaccctcatcaaaaatgcatgaattg
cctaaattaaataaaatcaatgaatcacctgctaatgcaaagctgtctgtatctgacaag
aagcagacagaggaagatgacagtgtggtggcagcacccccctctcctcggactttgctt
gctatccaggcagccatggtggaaagcagctcagaagaagaactggacacaggacaattg
agtgtggaccagtttgtgtcagaggaaggcagcgtgtctccaagaacactgcgggcaatt
cagcaagctctgagtgaagatgataaaggggaggaagttgttactgctacaactggtgga
gtgctgtcagaaagaccagaagggaaggattttctgctttgtagctcagatgaggaagag
cagattcctaaagttgagggaaaaaacattcctatagctacaattcattcatcaatccaa
gtgactatgcaagatgctaaatttaaacagaagagtcaggagttggaaaaaagtggtatt
acacccaaagacactgttatattcaaagatgaaaattattctgctattgaaaatactaga
aaaggcaaagaagatgtagacgaagaaaatgatttggaaaagcatattgcacccaaggac
gccagtatatccagagctgaaacgtatattgacaatactataaaggacacagaagatgta
gacagggaagaaaatggttccaaaaatcatatttcaccaaatgatacctgtatatccaga
gctgaaaattattcttacgttaacaatactagaaaagataaagaagacttggacaaagaa
aaaaatggttccaaaatggacttaaagtctctgggagagaaggatatgagtttgtgtttg
cagaagccaagctgttcccctgagcaaaccaatatagatgctttgattcacactgaaaca
acagacctttctaaaaatgagaaaaacttgaaagtttctgaaaatacacaggcagtaaat
tcacaaacagaggagaatgtatctgaggatattagactttttccagaagcaagagatcct
gaggtggaaagagaagggatatcacagtctgaagacagtgattctgatggaagctttatt
gaagtggatgctgaggtcagtaatgaggctgagtctcctactaaatatgatgaaaaggtg
ggtgatgagccaacacttgcagaagtggagtcagacagacctgatgctttcacagtggac
ttgcagaaggaatctgatgaggtgcagttgagaaacactcagaatattgaaggagaagct
gatggtaaagctgcagtggatgagtggcaagatatcagtttggaagaactagaagaatta
gaaaagaacctttctgctgagcagagtacacttcagtctcaaaaacagcagcaggaacgt
gttgctgcttctgtaacaggacagatgttcttggaaagccaggagctcctccgtctgttt
ggcattccatacatcgaagctccgatggaggccgaggcacagtgtgccatattggacctt
actgatcagacctctgggacaatcactgatgacagtgatgtttggttgtttggtgcacgc
catgtttataaaaatttcttcagtcagaacaaatacgtagaatattatcagtatgttgat
tttcagaatgagctagggttggatagaaacaagctaattaatttggcatacttgcttgga
agtgactacactgagggcatcccaaatgttggctttgtaacagcgatggagattttaaat
gaatttcctgggcatggcttggaacctctcttaaaatttgctgagtggtggaatgaggct
cagaagaataagaaagtgatgcctaatccacatgacaccaaagtcaagaagaaactgcgg
gagctacagctttattcgggtttcccaaatccagcagtggcagaagcatacctgaagcct
gtggtggatgagtcaaggggttcattcatctggggaaagcctgatgtagagcagatcaga
gaattctgcaaggatcactttggctggactaggacaaagatagatggaatccttttgcct
gtgatgaaacaactgaacttgcagcagactcagcttcgaatcgattcattcttcagatta
gaacagcatgaaaaacaagctattaaaagccagagactgcgcagagctgtgacttgtctg
aagagaaagggaaaggaggaagcagatgatgaaattcaggaggccactgctgtcatggag
atggaacttaaacagcctgggaaaaggaaaggggaaggtaccacaggctatgcaaatcaa
gctgcagcaacaaaagtacagagtggaaagagaagaaaacagtcagattccagaaaagaa
tttttatatggaggtggttttgttggaaatttgcatctttcagaaacttctagtgactcc
tcagtggaggaatccaaaggcagagatttaggcaagagcaaaaggaggaaaaacatgtct
gcaacagagacagcagaccataaagagaaaaaagggtgcagtagctcaagtggtgaggat
gaagatctgggaaatgtagtcatggtgactgccaaacctgtgtttgaaggcagaaaaaag
aaatcgcggagcaagagaggaataagaaagaaaatgtcttaa

DBGET integrated database retrieval system