KEGG   Geospiza fortis (medium ground-finch): 102031898
Entry
102031898         CDS       T03755                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04020  Calcium signaling pathway
gfr04260  Cardiac muscle contraction
gfr04261  Adrenergic signaling in cardiomyocytes
gfr04270  Vascular smooth muscle contraction
gfr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102031898
   04020 Calcium signaling pathway
    102031898
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102031898
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102031898
   04261 Adrenergic signaling in cardiomyocytes
    102031898
   04270 Vascular smooth muscle contraction
    102031898
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gfr04040]
    102031898
Ion channels [BR:gfr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102031898
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 102031898
NCBI-ProteinID: XP_005425343
LinkDB
Position
Un
AA seq 2104 aa
MNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQ
KKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKSFEIIILLTIFANCVALAIYIPFPE
DDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFS
AILEQATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLL
HIALLVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQN
GTECKAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSL
VIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDID
PENEDEGMDEEKPRNMSMPTSETESVNTDNVPGADMEGENCGARLAHRISKSKFSRYWRR
WNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFT
AEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIF
KITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRST
FDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNSILLNPA
XXXXVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMEKTAVEEETKEEKIELKS
ITADGESPPATKINVDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLK
EKAVPMPDASAFFIFSPSNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSF
RNQILFYFDIVFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQS
SAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGV
QLFKGKLYSCTDSSKQTEAECRGYYITYKDGEVSQPMIQPRSWENSKFDFDNVLTAMMAL
FTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVT
FQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFXX
XXNTICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFL
IVIGSIIDVILSETNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTL
LWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLL
FRCATGEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIIN
LFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLG
FGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAII
KKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNAL
SLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSY
YQSDGRSGFPQTFTTQRPLHINKSGNNHGDTESPSHEKLVDSTFTPSSYSSSGSNANINN
ANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTICVQEAPWKLPSKRXVSRDSQLAIVCQE
EVSQDETYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTPPEHSKGEDTRHSPKKGFL
CSSALGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTAF
SRLCATPPATPCNRGWPQQSIPTLRLDGADSSEKLNSSLPSVHCGSRYPESGGSPRRARP
VSLTVPSPSAGSSRQFHGSASSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEE
MENAADNILNGNSKQSPNGNLLPFANCRDPGQDSAGEEEEEVQNPDCRISQEELKDSRIY
ISSL
NT seq 6315 nt   +upstreamnt  +downstreamnt
atgaatgccaatgcagctgcagggcttgccccggagcacatccccacgccaggggcagct
ctgtcctggcaggctgccatcgatgctgccaggcaagccaagctgatgggcagcgctggc
aacgccaccatctccacggccagctccacgcagaggaaacggcagcagtatggcaagcag
aagaagcagggcaccaccacagccacccgtcctccccgggcactgctgtgcctcacgctg
aagaatcccatccggagggcgtgcatcagcatcgtcgaatggaaatcatttgaaataatt
attttactgactatttttgccaattgtgtggccttagctatctatatcccctttccagaa
gatgattccaatgccaccaattccaatctggaacgagtggaatatctctttctcataatt
tttacagtggaagcatttttaaaagtaatagcatacggacttctctttcaccccaacgct
tacctccgcaatggctggaatttactagattttataattgtggtagtagggctttttagt
gcaattttagaacaagcaaccaaagcagatggagggaattcaataggaggaaaaggtgcc
ggattcgatgttaaagcactgcgggctttccgagtattacgtccactacggctggtgtct
ggagttcctagtctccaggtggttttaaattcaattatcaaggccatggtccctttgttg
catattgccctgctggtgctgtttgtcattattatctatgccatcattggactggagtta
ttcatggggaagatgcacaagacctgctaccatgtgcaagggggactgatagatacacct
gcagaagacgatccgtccccgtgtgccccccagtctgcccacgggcggcagtgtcagaac
ggcaccgagtgcaaggcgggctgggagggacccaagcatggcattaccaactttgacaat
tttgcttttgccatgctcacggtgtttcagtgcatcaccatggagggctggacagatgtg
ctctactggatgcaggacgctatgggctatgagttaccatgggtgtattttgtcagtctg
gtcatctttggatcctttttcgttctaaatctggttcttggtgtgttgagcggggagttt
tccaaagaaagagaaaaggccaaggctcgaggcgatttccagaagctacgggaaaagcag
cagctagaggaggatctgaagggatacttggactggataactcaagcagaagatattgat
ccagaaaatgaagatgaaggcatggatgaggagaagcctcgaaacatgagcatgcccacc
agcgagaccgagtccgtgaacaccgacaacgtccccggagcggacatggaaggcgagaac
tgcggcgcgaggctggcgcatcggatctcaaagtcaaaatttagtcgctactggcgccga
tggaatcgattctgcagaaggaagtgccgtgctgctgtcaagtccaatgttttctattgg
ctggtgatcttcctcgtgtttctcaacaccctcaccattgcctctgagcactacaaccag
ccagactggctcacggaggtccaagacactgccaataaggtgctgctagctcttttcacg
gcagagatgctgctgaagatgtacagccttgggctccaggcctactttgtgtccctcttc
aaccgcttcgactgtttcatcgtgtgtggaggcatcctggaaaccatcctggtggagaca
aagatcatgtcacccctgggcatttcggtcttgagatgtgtgagactcctcagaatattt
aaaatcacaagatattggaactccctgagtaatcttgtggcttcactcctgaattcagtc
cgctccattgcctccctgttgctgcttctcttcctcttcatcatcatcttctccctcctg
gggatgcagctctttgggggcaagtttaactttgatgagatgcagaccaggaggagtaca
tttgacaacttccctcagtccctcctgactgtgtttcagatcctgactggggaggactgg
aattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggaatgttg
gtctgtatttacttcatcatcctcttcatctgtggaaactccattctgttaaatcctgct
gannnnnnnnnngtggacaaccttgctgatgctgagagtttaacatctgcacagaaagag
gaggaagaggaaaaagaaaggaaaaagctagctaggactgctagtcccgaaaagaaacag
gagatggagaaaacagctgtggaggaagagacaaaggaggagaaaattgagctgaaatcg
atcactgctgatggagagtctccaccagctaccaagatcaacgtggatgattaccagccc
aatgaaaatgaagaaaagagcccttatcccacaacagaagcaccagcagaggaagatgag
gaagaacctgagatgcctgtcggccctcgacctcgcccgatgtctgagctgcacctcaag
gaaaaggctgtgcccatgcctgatgccagtgcttttttcatcttcagtcctagcaacagg
tttcgcgtgcactgccatcgcatcgttaacgataacattttcaccaacctgatcctgttt
ttcatcctgctcagcagcatctccctggcagctgaggaccccgtgagacacctctccttt
aggaaccaaattctcttttattttgatatagtttttactgtcattttcaccattgaaatt
gctctgaagatgactgcctacggggctttcctccacaagggctccttctgcaggaactat
ttcaacatcttggacctgctggtggtcagcgtttctctcatctcctttgggatccagtcc
agtgccattaatgtggtgaagatcctgcgtgttctgcgggtcctcaggccactgagggcc
atcaacagagccaaaggactaaagcacgtggtccagtgcgtgtttgtcgctatccgaacc
atcgggaacattgtgattgtcaccactttgctgcagttcatgtttgcctgcattggagtt
cagctgtttaagggcaagctgtacagctgcactgacagctccaagcagacagaagcagaa
tgcagagggtactacatcacctacaaggatggggaggtcagccagcccatgatacagccc
cgcagctgggagaacagcaagtttgacttcgacaacgtcctgactgccatgatggccctc
ttcaccgtctccaccttcgagggctggccagagttgctgtataggtccattgattcccac
atggaggatgtgggacccatctataatcacagggttgagatctccatcttctttattatc
tacatcatcatcattgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcaca
tttcaggaacaaggagaacaagagtacaagaactgtgagctggacaaaaaccagcgccag
tgtgtagagtatgccctgaaagcccggcctctgcggagatacatccctaaaaaccagtac
cagtacaaagtttggtatgtggtcaactccacctattttgaatacctgatgttcngnnnn
nnnnnnaacaccatctgcctggccatgcaacactatggtcagagctgcatgttcaaggaa
gccatgaacatcctcaacatgctcttcactgggctcttcactgtggagatggtcctgaag
ttaattgccttcaaacccaagggttactttagtgatccttggaatgtttttgacttcctc
atcgtaattggcagcattatagacgtcattctcagtgaaactaatccagctgaacatacc
caatgctcttcctctatgaacgcagaggaaaactctcgcatctcaatcaccttcttccga
ctcttccgcgtgatgcgcctcgtgaagctcctgagccgaggggagggcatccggacactg
ctgtggaccttcatcaagtccttccaggctctcccctacgtggctcttttaatagtgatg
ttgttcttcatctacgctgtgattgggatgcaggtgtttggtaaaattgcgctgaacgac
accacagaaatcaaccgcaacaataacttccagaccttcccccaggcagtgctgctgctt
ttcaggtgtgccacaggtgaggcctggcaggaaatcatgctggcatgtctccctgacaag
aagtgtgacccggagtcggagccggccaactccacagaggccgatcactcgtgtggcagc
agcttcgccgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaat
ctttttgtcgctgttataatggataacttcgattacctgacacgggactggtccatttta
ggaccacaccacctggatgagtttaaaaggatctgggcagagtatgaccctgaagctaag
ggacggatcaagcacctggacgtggtgacgctgctgcggcggatccagcccccgctgggc
tttgggaagctctgccctcaccgggtggcttgcaaacgccttgtctccatgaatatgcca
ctgaacagcgatgggactgtcatgttcaatgccactctctttgcactggtcagaacagca
ctgaggatcaagacagaaggtaacctggagcaagccaacgaagagctgagagcaataatt
aagaaaatctggaagcgcaccagtatgaagctgctggaccaggtggtgcctcctgcaggt
gatgacgaggtgaccgtggggaagttctacgccactttcctgatccaggagtatttcagg
aagttcaagaagcgcaaagagcaggggctggtggggaagccctcccagcgcaacgcgctc
tccttacaggctgggctgcgcacgctgcacgacattgggcccgagatccgacgggccatt
tctggagacctgaccgcggaagaggagctggacaaggccatgaaggaagctgtttctgct
gcctcggaagatgatatcttccggagagctggaggcttgtttggaaaccatgtgagctac
taccaaagtgatggcaggagtgggttcccccagacattcaccacccagagacctttgcac
atcaacaagtctggcaacaaccacggcgacaccgagtctccatctcacgagaagctggtg
gactccaccttcactcccagcagctactcatcttcaggctccaatgccaacatcaacaat
gccaacaacaccgccctgtgtcgcttccccagcccacccagctaccccagcactgtcagc
acggtggaaggccacgggacccccctgtcacccaccatctgcgtgcaggaggctccctgg
aagctcccctccaaaaggtgagtttccagagacagccagctggcaattgtttgccaagag
gaagtgtctcaggatgagacttatgatgaaaatttgaatgaagacattgagtactgtagt
gaaccaagtctgctctctaccgaaatgcttgcataccaagatgatgaaaacagacaactc
actccaccagagcacagcaaaggagaggacacccggcactctcccaagaaggggttcctg
tgctcctcagctctaggtcgaagagcatcttttcacttagagtgtttgaaaagacagaaa
aaccagggtgtggatgtctcacagaagacagtcctgcctttgcatctggtccatcatcag
gccctggcagtggctggcctgagtcccctgctgcagcgaagccattcccccaccgcgttc
tctcggctgtgtgctacgcccccggccacgccctgcaaccggggctggccgcaacagagc
atccccacgctgcgcctcgacggggcggactcctcggagaagctcaacagcagcttgccg
tccgtgcactgcggctcccggtaccccgagagcggcggcagccccaggagagcccggccc
gtgtccctgaccgtgcccagccccagcgcagggagcagccggcagttccacggcagcgcc
agcagcctggtggaagcggtcttgatttcggaaggactgatgcagtttgctcaagatcca
aagttcattgaggtcacaacccaggagctcgcagacgcctgcgacatgacgatagaagag
atggaaaatgcagcagacaacattctcaatggtaacagcaagcagagccccaatggcaac
ctcttgccttttgctaactgcagggacccagggcaggacagtgcaggagaggaagaggaa
gaggtgcagaacccggattgtaggataagtcaggaggagctcaaggacagcaggatttat
atcagcagcctgtag

DBGET integrated database retrieval system