KEGG   Geospiza fortis (medium ground-finch): 102031971Help
Entry
102031971         CDS       T03755                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00010  Glycolysis / Gluconeogenesis
gfr00051  Fructose and mannose metabolism
gfr00052  Galactose metabolism
gfr00500  Starch and sucrose metabolism
gfr00520  Amino sugar and nucleotide sugar metabolism
gfr00524  Neomycin, kanamycin and gentamicin biosynthesis
gfr01100  Metabolic pathways
gfr01200  Carbon metabolism
gfr04910  Insulin signaling pathway
Module
gfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gfr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102031971 (HK1)
   00051 Fructose and mannose metabolism
    102031971 (HK1)
   00052 Galactose metabolism
    102031971 (HK1)
   00500 Starch and sucrose metabolism
    102031971 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102031971 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102031971 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102031971 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gfr04131]
    102031971 (HK1)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102031971 (HK1)
Membrane trafficking [BR:gfr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102031971 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102031971
NCBI-ProteinID: XP_005429022
LinkDB All DBs
Position
Un
AA seq 906 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLLDVMARFRREMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGFLITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQXVPLLLPLALLLPRALLCKGPPLPTGAAGRPDQPRLIDETLAEFKLTHEQLLQVKKRM
RAEMEAGLQKKTHDTAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRR
TVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGFTFSFPCKQTSL
DAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEDPN
CEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDDIRTIYDKAVDD
FSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRHIFETKFLSQIE
SDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAAIVDKIRENRGL
ERLEITVGVDGTLYKLHPHFSRIMHQTVKELAPNCDVTFLLSEDGSGKGAALITAVGCRL
REAEQN
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctgaaggaggaccaggtcaaa
aagattgacaagtacctctacgccatgcggctctcggacgaaacgctgctggacgtcatg
gcccgcttcaggagggagatgaagaacggcctctccagggatttcaacccaacagccact
gtgaagatgcttcccacctttgtgaggtccattcctgatggttcagagaaaggagatttc
attgcactggacctcggtggctcttacttccgaatccttcgggtgaaggtttcgcatgag
aagaagcagacggtgcagatggaaagtgaaatttacaataccccagaggacatcatgcat
gggagtgggacacggctttttgatcatgttgctgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaaactgccagtcgggtttacattttccttcccctgtcgacaa
tccaagctagatgagggttttctgataacctggacgaagcgcttcaaagcgagcggagtg
gagggagcagacgtcgtgaggctgctcaacaaggccatcaagaaacgtggggactacgat
gcagacatcatggctgtggtgaacgacaccgtgggcaccatgatgacctgtggctttgac
gaccagcgctgcgaagtcggcctcatcatcggcacgggcaccaacgcctgctacatggag
gagatgaggcacatcgacctggtggagggggatgagggcaggatgtgcattaacaccgag
tggggcgccttcggggacgacggctcgctggaggacatcaggaccgagttcgatcgggag
attgaccgcggatcccttaatcctggcaagcagctgtttgagaagatggtcagtgggctg
tacatgggggagctggtaaggctcatcctggtgaagatggccaaggaggggctgctcttt
gaggggagaatcacccctgagcttctcaccaaagggaagtttgagacaaagcatgtttct
gccattgaaaagagcaaagaaggtctgaacaaagccaaagagatcctgaccaggctgggg
gtggagccgtcccatgaggactgcatcgctgtgcagcacgtctgcaccatcgtgtccttc
cgctccgccaacctggtggcctccacgctgggtgccatcctcaaccagctgagggacaac
aagggcgtgggccgcctgcgcaccaccgtgggcgtggatggttctctctacaagatgcac
ccacagtgagtgcccctgctcctgccactggcacttctactgccacgggctctgctttgc
aaagggcctcccctccccacaggtgctgccgggcggcccgaccagccccgcctcatcgac
gagaccctggccgagttcaagctcacccacgagcagctgctgcaggtgaagaagaggatg
agggcggagatggaggcggggctgcagaagaagactcacgacaccgctaaagtgaagatg
ctgcccaccttcgtgcgcagcacgccggatgggacagagaatggagactttctggcactt
gaccttggagggacaaactttagagttttgctggtgaaaatccgcagtggtaaaaggaga
acagtggagatgcacaacaagatctatgccattcccatagaggtgatgcagggaacagga
gaagagctgtttgatcacatcgttacctgcatttctgacttcctggattatatggggata
aaaggagcacgtcttcctcttggcttcaccttttccttcccttgcaagcagaccagtctg
gatgctggtatccttctgaattggacaaaaggcttcaaagctacagactgtgagggagaa
gatgtggtatatttacttagagaaggaattaaaagaagagaggaatttgacttggatgtg
gtggctgtggtgaatgacacagtgggcacaatgatgacttgtgcttatgaagatccaaac
tgtgaaattgggctcattgtaggaacgggcagcaatgcctgttacatggaggagatgagg
aacatagagatggtggatggtgagcagggcaggatgtgtgtgaacacggagtggggagcc
tttggggacaacggctgcctggatgacatcaggacaatatatgacaaagcagtcgatgac
ttctccctgaatgctggcaagcagaggtatgagaaaatgatcagtgggatgtacctgggg
gaaatagttcgcaatattttgatcgacttcaccaaacggggtttcctgttccgaggccag
atttcagagacactgaagaccaggcacatctttgaaaccaagttcctttctcagattgag
agtgacaggttagccctgctgcaggtgagaaccatcctccagcagctggggctcaacagc
acctgcgacgacagcatcatcgtcaagacagtctgcggggcggtgtcgaggcgagcagcc
cagctctgtggtgctggaatggctgccattgtagataaaattagggagaacagagggttg
gagcgcctggagataacggttggtgtggatggaactctctacaaactccacccacacttc
tcgaggatcatgcaccaaacagtcaaagagctggcacccaactgcgacgtgaccttcctg
ctgtcggaggacggcagcgggaaaggggcagcgctcatcacagccgtgggatgcaggctt
cgtgaggctgagcagaactga

DBGET integrated database retrieval system