KEGG   Geospiza fortis (medium ground-finch): 102031991
Entry
102031991         CDS       T03755                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102031991 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102031991 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gfr04052]
    102031991 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:gfr00536]
    102031991 (FGF1)
Cytokines and growth factors [BR:gfr04052]
 Growth factors
  Growth factors (RTK binding)
   102031991 (FGF1)
Glycosaminoglycan binding proteins [BR:gfr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102031991 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102031991
NCBI-ProteinID: XP_005418881
UniProt: A0A6I9HF79
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFSALTEKFDLPAGSYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDEHIQLQ
LSAESVGVVHIRSTQSGQYLAMDTNGLLYGSQLLGEECLFLERLEENHYNTYVSKMHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggagatcaccacgttcagcgccctgaccgagaagttcgacctgcccgcg
ggcagctacaagaagcccaagctgctgtactgcagcaacggggggcacttcctgcgcatc
ctgcccgacggcaccgtggatggcacccgggaccgcagcgacgagcacatccagctccag
ctgagtgcagagagcgtgggggtggtgcacatcaggagcacccagtcggggcagtacctg
gccatggacaccaacgggctgctctacggctcgcagttactgggtgaggagtgtctgttc
ctggaaaggctcgaggagaaccattacaacacctacgtctccaaaatgcacgcggacaag
aactggtttgtggggctgaagaagaacgggaacagcaagctgggcccgcggactcactac
ggccagaaggcgatcctcttcctgcccctgcccgtctctgccgactga

DBGET integrated database retrieval system