Geospiza fortis (medium ground-finch): 102032008 Help Entry 102032008         CDS       T03755                                  Gene name BCL2 Definition (RefSeq) BCL2, apoptosis regulator   KO K02161   apoptosis regulator Bcl-2 Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04115   p53 signaling pathway gfr04140   Autophagy - animal gfr04141   Protein processing in endoplasmic reticulum gfr04210   Apoptosis gfr04217   Necroptosis gfr04261   Adrenergic signaling in cardiomyocytes gfr04340   Hedgehog signaling pathway gfr04510   Focal adhesion gfr04621   NOD-like receptor signaling pathway gfr05132   Salmonella infection gfr05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102032008 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     102032008 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102032008 (BCL2)   09143 Cell growth and death    04210 Apoptosis     102032008 (BCL2)    04217 Necroptosis     102032008 (BCL2)    04115 p53 signaling pathway     102032008 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102032008 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102032008 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102032008 (BCL2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102032008 (BCL2)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     102032008 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gfr01009]     102032008 (BCL2) Protein phosphatases and associated proteins [BR:gfr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102032008 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 SipA DUF2200 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102032008 NCBI-ProteinID:  XP_014163622 LinkDB All DBs Position Un AA seq 137 aa AA seqDB search MCVESVNREMSHLVDSIAAWMTEYLNRQLHNWIQDNGDGVNWGRIVAFFEFGGVMCVESV NREMSHLVDSIAAWMTEYLNRQLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILS LVLVGACITLGAYLGHK NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgtgcgtggagagcgtcaaccgggagatgtctcacctcgtggacagcatcgctgcctgg atgaccgagtacctgaaccggcagctgcacaactggatccaggacaacggagatggggtt aactggggcagaattgtggccttcttcgagtttggcggtgtgatgtgcgtggagagcgtc aaccgggagatgtctcacctcgtggacagcatcgctgcctggatgaccgagtacctgaac cggcagctgcacaactggatccaggacaacggaggctgggatgcctttgtggagttgtat ggcaacagtatgaggcctttgttcgatttctcctggatctctctgaagactatcctgagt ctggttctggtgggagcttgcatcactcttggcgcttatctcggacataagtag

DBGET integrated database retrieval system