KEGG   Geospiza fortis (medium ground-finch): 102032008
Entry
102032008         CDS       T03755                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04140  Autophagy - animal
gfr04141  Protein processing in endoplasmic reticulum
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr04261  Adrenergic signaling in cardiomyocytes
gfr04340  Hedgehog signaling pathway
gfr04510  Focal adhesion
gfr04621  NOD-like receptor signaling pathway
gfr05132  Salmonella infection
gfr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102032008 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102032008 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102032008 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    102032008 (BCL2)
   04217 Necroptosis
    102032008 (BCL2)
   04115 p53 signaling pathway
    102032008 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102032008 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102032008 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102032008 (BCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102032008 (BCL2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102032008 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gfr01009]
    102032008 (BCL2)
Protein phosphatases and associated proteins [BR:gfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102032008 (BCL2)
SSDB
Motif
Pfam: Bcl-2 SipA DUF2200 Bcl-2_3
Other DBs
NCBI-GeneID: 102032008
NCBI-ProteinID: XP_014163622
LinkDB
Position
Un
AA seq 137 aa
MCVESVNREMSHLVDSIAAWMTEYLNRQLHNWIQDNGDGVNWGRIVAFFEFGGVMCVESV
NREMSHLVDSIAAWMTEYLNRQLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILS
LVLVGACITLGAYLGHK
NT seq 414 nt   +upstreamnt  +downstreamnt
atgtgcgtggagagcgtcaaccgggagatgtctcacctcgtggacagcatcgctgcctgg
atgaccgagtacctgaaccggcagctgcacaactggatccaggacaacggagatggggtt
aactggggcagaattgtggccttcttcgagtttggcggtgtgatgtgcgtggagagcgtc
aaccgggagatgtctcacctcgtggacagcatcgctgcctggatgaccgagtacctgaac
cggcagctgcacaactggatccaggacaacggaggctgggatgcctttgtggagttgtat
ggcaacagtatgaggcctttgttcgatttctcctggatctctctgaagactatcctgagt
ctggttctggtgggagcttgcatcactcttggcgcttatctcggacataagtag

DBGET integrated database retrieval system