KEGG   Geospiza fortis (medium ground-finch): 102032034
Entry
102032034         CDS       T03755                                 

Definition
(RefSeq) uncharacterized LOC102032034
  KO
K08774  transforming growth factor, alpha
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102032034
   04012 ErbB signaling pathway
    102032034
SSDB
Motif
Pfam: LSM DUF1180
Other DBs
NCBI-GeneID: 102032034
NCBI-ProteinID: XP_014166695
LinkDB
Position
Un
AA seq 266 aa
MRVVVMMETMRMMMGMMVRTLMVTMLGEDEGGGHDGDNGDDDGDVDGDNDGDIDGDNDGV
LLAACHALDNSTAGRSAPVAAAVRSHFNECPDSHRQFCFHGPCRFLVQEEKPACVCQWCY
VGTRCEHADLLAVVAATQKKQTITALLVVAVVASALLVTVCVLVHCCRLRKRWPWPHIPV
PMSLSPFHVPVPVPSLSPLLSPAAVACGMKLNGGRHVQGILRGFDPFMNLVIDECVEMAA
GGQQNNIGMVVIRGNSIIMLEALERV
NT seq 801 nt   +upstreamnt  +downstreamnt
atgagggtggtggtgatgatggagacaatgaggatgatgatggggatgatggtgaggaca
ttgatggtgacaatgttgggtgaggatgagggtggtggccatgatggggacaatggggat
gatgatggggacgttgatggtgacaatgatggggacattgatggtgacaacgatggtgtc
ctgctggccgcgtgccacgcgctggacaacagcacggccggccggagcgccccggtggcg
gcggcggtgaggtcgcacttcaacgagtgccccgactcgcaccggcagttctgcttccac
ggcccctgccgcttcctggttcaggaggagaaacccgcctgcgtgtgtcagtggtgctac
gtggggacgcgctgtgagcacgctgacctgctggccgtggtggcagccacccagaagaag
cagaccatcacggccctgctcgtggtggccgtggtggcctcggccctgctcgtcaccgtc
tgcgtgctggtccactgctgtcgcctgcggaagcgctggccctggccccacatccccgtc
cccatgtcactgtccccattccatgtccctgtccctgtcccatcgctgtccccgttgctg
tccccagctgctgtcgcctgcggaatgaagctgaacggcggccggcacgtgcagggcatc
ctgcggggcttcgaccccttcatgaacctggtgatcgacgagtgcgtggagatggcggcg
ggcgggcagcagaacaacatcggcatggtggtgatccgagggaacagcatcatcatgctg
gaagctttggaacgagtataa

DBGET integrated database retrieval system