KEGG   Geospiza fortis (medium ground-finch): 102032130
Entry
102032130         CDS       T03755                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 26-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04060  Cytokine-cytokine receptor interaction
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr05132  Salmonella infection
gfr05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102032130
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102032130
   04217 Necroptosis
    102032130
   04115 p53 signaling pathway
    102032130
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102032130
  09172 Infectious disease: viral
   05164 Influenza A
    102032130
Cytokine receptors [BR:gfr04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102032130
CD molecules [BR:gfr04090]
 Proteins
  102032130
SSDB
Motif
Pfam: Death TNFR_c6 SBP_bac_6
Other DBs
NCBI-GeneID: 102032130
NCBI-ProteinID: XP_005427274
UniProt: A0A6I9HQH8
LinkDB
Position
Un
AA seq 307 aa
MGITMRAGRAAGLLLVVLLTMPRARANCGETEYFHQGLCCVFCEAGTFVADHCNASHLKG
KCDPCKEGEGFIAHPNGLEECLPCRQCKEDQITLRPCTLTQNAECQCKQGYFCDDEGCEM
CRRISQEHPDGKEILLNSTDTRELGLTNPGKEAHVWVILVLLLAVLGLLILVVLVKKLKC
DKAASTVKDVEGQLVQEPSQIIVKDLSQCELRETCDVFTKEVPPQQWKQLMRPLLQQNDI
DKVISKFPNNREEQSYQMLLIWKKRLGKKQCINNLLDALKHIDTKAYYSVLNTLKSNNII
SKVEAED
NT seq 924 nt   +upstreamnt  +downstreamnt
atgggcatcaccatgagagccgggcgagcggcggggctgctgctggttgtactactgacg
atgcctagagcccgagcaaactgtggggagacagagtacttccatcaaggtctctgctgt
gtgttttgtgaagcaggtacctttgttgctgaccactgcaatgcttcgcatttgaaagga
aaatgtgacccttgcaaggaaggagaaggctttattgcccatcccaatggcttggaggaa
tgcttgccttgcagacagtgcaaagaggatcagataactctgagaccctgtactctgaca
cagaatgctgaatgccagtgcaaacaagggtatttctgtgatgatgagggctgtgaaatg
tgtcggagaatcagtcaggagcatccagatgggaaagaaatcctgctgaattccactgat
accagagaactaggcttaactaatccagggaaggaagctcatgtttgggttattctagtg
cttctgttggctgttttgggcttgctcatacttgttgttcttgttaaaaagctgaagtgt
gataaagctgcctcaactgttaaagatgtagagggacaactggtacaagaaccaagtcag
ataattgttaaagatctctctcaatgtgaactgagagagacctgtgatgtctttacaaag
gaagtaccaccgcaacagtggaagcagcttatgagacctcttctacagcaaaatgatatt
gataaagttatttctaaatttcctaataatagagaagaacaatcctatcagatgcttctc
atctggaaaaagagactgggaaagaaacaatgtattaataatttactggatgcattgaag
cacatagataccaaggcttattacagtgtattaaacactttaaaaagtaataacattata
agtaaagtagaagctgaagattaa

KEGG   Geospiza fortis (medium ground-finch): 102033914
Entry
102033914         CDS       T03755                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10A-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04060  Cytokine-cytokine receptor interaction
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr05132  Salmonella infection
gfr05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102033914
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102033914
   04217 Necroptosis
    102033914
   04115 p53 signaling pathway
    102033914
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102033914
  09172 Infectious disease: viral
   05164 Influenza A
    102033914
Cytokine receptors [BR:gfr04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102033914
CD molecules [BR:gfr04090]
 Proteins
  102033914
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 102033914
NCBI-ProteinID: XP_014167044
LinkDB
Position
Un
AA seq 328 aa
MGTYLTKECEEQRGSSTCEPCGLGEYMEYPNALLSCQECSKCKEDQVELSPCQPQRNTVC
ACSNGTFCPPEHPCEMCQKCQPRCPKGQVMLKPCTPYSDLQCGPDTAAFPSYLKALTGIV
AIAVIVTGIAVCCWKCRCSSPVCVSPLPLNSMFQKMLWCKTENVGTEDNNANTETERDRA
AERQEMLPSRSERPWRTLVPAPETEPSQGECWGPGEVLAGIAVPAARALSCPFAPPVLKS
YFYTFGRKVPRDDWKRFGHSLNLEDNDITTGKTLDDFYDMMRRWQNREGSKASVNTLLDT
LERLSLGGVAEDICDTLVREGRFQYETS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggcacctaccttaccaaggagtgtgaggagcagagaggctccagcacgtgtgagccc
tgtggactcggggaatacatggaatatccaaacgccctcctgtcctgccaggagtgctcc
aagtgcaaggaagatcaggtggagctgagtccctgccagccccagaggaacacggtgtgt
gcctgcagcaacggcaccttctgccccccggagcacccctgtgagatgtgccagaagtgc
cagcccaggtgtcccaagggccaagtgatgctgaaaccctgcacaccctacagtgacctc
cagtgtggtcctgacacggccgccttcccctcctacctcaaggccctcacagggattgtt
gcgatagctgtgatcgtgactgggattgctgtctgctgctggaaatgccgctgcagctcc
ccagtttgtgtctctcccttgccactgaactccatgtttcagaagatgctgtggtgcaag
acagagaacgtgggcacagaggacaacaacgccaacacggagacagagagggacagggca
gcagagagacaggagatgctgccaagtaggagtgagagaccctggaggactctggttcca
gcaccagagactgaacccagtcaaggtgagtgctggggcccaggggaagtgctggctggg
attgctgtccctgctgcccgtgctctgagctgtccctttgcccctccagtgctgaagagc
tacttttacacctttgggaggaaagtgcccagagatgactggaagagattcggccacagc
ctgaacctggaggacaacgacatcaccacgggcaagaccctggatgatttctacgacatg
atgcgcaggtggcagaacagggagggctccaaggcctctgtgaacaccctgctggacacc
ctggagcgcctcagcctcgggggggtggcagaggacatctgtgacacgctggtgcgggag
ggacgttttcagtacgaaacgagctga

DBGET integrated database retrieval system