KEGG   Geospiza fortis (medium ground-finch): 102032215
Entry
102032215         CDS       T03755                                 

Gene name
IGF1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04068  FoxO signaling pathway
gfr04114  Oocyte meiosis
gfr04115  p53 signaling pathway
gfr04150  mTOR signaling pathway
gfr04510  Focal adhesion
gfr04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102032215 (IGF1)
   04068 FoxO signaling pathway
    102032215 (IGF1)
   04150 mTOR signaling pathway
    102032215 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102032215 (IGF1)
   04115 p53 signaling pathway
    102032215 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102032215 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102032215 (IGF1)
Cytokines and growth factors [BR:gfr04052]
 Growth factors
  Growth factors (RTK binding)
   102032215 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 102032215
NCBI-ProteinID: XP_005421104
UniProt: A0A6I9HIF0
LinkDB
Position
Un
AA seq 153 aa
MEKINSLSTQLVKCCLCDFLKVKMHTVSYIHFIYLGLCLLTLTSSVAAGPETLCGAELVD
ALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSARS
VRAQRHTDMPKAQKEVHLKNTSRGNTGNRNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggaaaaaatcaacagtctttcaacacaattagttaagtgctgcttgtgtgatttcttg
aaggtgaagatgcacactgtgtcctacatccatttcatctaccttggcctgtgtttgctt
accttaaccagttctgttgctgctggcccagagacactctgtggtgctgagctggttgat
gctcttcagttcgtgtgtggagacagaggcttttacttcagcaagcccacggggtatgga
tccagcagtagacgcttacaccacaagggaatagtggatgaatgctgcttccagagctgt
gacctgaggaggctggagatgtattgtgctccaataaaaccgcccaaatccgcgcggtcc
gtacgcgcccagcgccacaccgacatgccaaaagcacaaaaggaagtgcatttgaagaac
acaagtagagggaacacaggaaacagaaactacagaatgtaa

DBGET integrated database retrieval system