KEGG   Geospiza fortis (medium ground-finch): 102032229
Entry
102032229         CDS       T03755                                 

Gene name
ATR
Definition
(RefSeq) ATR serine/threonine kinase
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr03460  Fanconi anemia pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    102032229 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102032229 (ATR)
   04115 p53 signaling pathway
    102032229 (ATR)
   04218 Cellular senescence
    102032229 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102032229 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gfr03400]
    102032229 (ATR)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102032229 (ATR)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102032229 (ATR)
DNA repair and recombination proteins [BR:gfr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102032229 (ATR)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC HEAT Mad3_BUB1_I TRIF-NTD Dopey_N
Other DBs
NCBI-GeneID: 102032229
NCBI-ProteinID: XP_005424760
LinkDB
Position
Un
AA seq 2742 aa
MTKTKLRVDCPPRVLSLRFTPVHDPSFYPFLSRTCGTRCPGGATRSRSAPDRVPTGIPST
PSVLYTRKRSQQKRIKSNIRSESNNNNKKESLYLTHAAHRYLASPEEYNTVVQKPRQILC
QFVDRILTEVDVVALELIKKSDSQPSSVMLLDFIQHIMKSSPLMFVNVDGNQEETQCSCI
EFSNWIITRLLRIAAAPNCNTLHKNICDVICSLLFLFKMKSGSIFEALTKDLLHLFQDLI
ILHERDAQKHPWGDGLVWPVTVERFSSNMSDKVGYLRLAPLQLMGMPNIEYLEVVLMSIL
TNIAADIFFVRQDIILWGIGCSVLEYGSPKVKTLTMKFIVKLIHLGGPPEQLASVFFSVF
FEILQSALEMDTEESELFGEPLLLLVRTLLPFEAHSYKNIEPVYLNMLLEKLCSWFEGDV
FRCLQSEKLKTVFCHMLQYFLEFVPAGYESALLIRKARISTICRIFVNVLGTQEEQKYLV
SPLYTALKTQTEEIFEEIQQNQLESSDTDGWSSSSDEVPEKRRRLSLPTKHPKKSPAPLI
LSPVNMKLKSALWNAITKKAASLISVLEEEVLPGDVLQAVEGIAVILRLAALCIVHCSPP
TDSSRXNKEHGVSHPCSSDTGKNTPSSLDSMVNIQFKWISSDFTTRVVKVCRNLLEAATQ
IVNLEQVIDRIVKIVDALLYAQVKIPLSDQILDDLCGLLSLPWIYSHPDDSSFKPSIWGF
GPLVLSQKTAQSFSPQTQSHCVFLLTLFPKNIHLDWRKSVYHWALQSHHEIIRATCVKGF
SLLLQPVQSCSVIPRALLNQIKDESELVKEACAAIVGKLSCCLSGPFHLQPSLADSAVKD
VTHDILCSSLTVTSAHGKTSSVQACVFKPFFILLESKAPSSVKLAFIENIPHLCKHLDFN
TDESSVKSLVGSLLNLMEDPDKDVRVAFSNCIKNILESLDSEEGFIKELFVSRMKEAYTN
AKMSRNNELKDTLILTTGDIGRASKGELVPFALLHLLHCLLSKSPSVAGAAYTEIRALAA
AKAIKLQAFFSQYKKPICQFLVESLHSSQMVVLSAPCQGNELQKETAAHQREMALDMLSE
IASVFDFPDLNRFLSRTLQVLLPDLAAKASPAASTLIRTIAKQLNVNRREILINNFKYIF
SHLVCSCTKDELERALHYLKNETEIELGSLLRQDYQGLHNELLLRIGEHYQQVFNGLSIL
ASFASQDDPYQGPKEITSPEQMADYLQPKLLGILAFFNMQLLSSSVGIEDKKMALNSLRS
LMTLMGPKHISSVRVKMMTTLRTALRYKDDFPELCCRAWDCFVRSLDHSYLGSLLSQVIV
VLLPLIHIQPKETTAIFHFLIVENRDTVQDFLHEIYFLPDLPELKEVQVVLQEYRKESSK
STDLQTALQLSMRAIQHENVDVRIHALTSLKETLYRNQEKLIKYVTDSETVEPVISQLVT
VLLIGCQDANSQARLLCGECLGELGAIDPGRLDFSTSETQGKHFTFVAGVEDSNFAYGLL
MELTRAFLAYADNVRAQDSAAYAIQELLSIYDCRETNTDCPGSRLWRRFPEHVQEILEPH
LNTRYKSYQKAVNWSKVKKPIYLSKLGDNFAEWSATWAGYLITKVRHDLARKVFDCCSIM
MKNDYKVTIYLLPHILVYVLLGCSQEDQQEVYMEIMAVLTHDDQCSRRLEDSASDLSQLS
TQTVFSMLDHLTQWARHKFQTLIAEKNAGKSSKDRSDLKTSSEDYGEYQNVTRFLDLIPQ
DTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLYAAMHEPDGVAGVSAIRKA
EPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYHGAVKSMLGLGQLSAVITQVNG
VLANRSEWISELNTYRVEAAWKLSQWDLLENYLASDVKSTTWSVRLGHLLLSAKKKNEAA
FYETLKVVRAEQIVPLSAASFERGSYQRGYEHIIRLHMLCELEHSIGPMFQQADGDHSRD
SLNWCARIEMTQNSYRAKEPILALRRALLSLSKSQDYSELVGQCWLQSARVARKAGHHQT
AYNALLNAGESTLSELYVERAKWLWSKGEVHEALIVLQKGVELCFPENKAPCSSKNQLIH
GRAMLLVGRFMEETANFESNAVMKKYKDVTVFLPEWEDGHFYLAKYYDKLMPMVTDNKME
KQGDLIRYIVHHFGRSLQYGNQFIYQSMPRMLSLWLDFGAKAYECDKAGRSERVQMKNDL
AKINKVITEHTNHLAPYQFLTAFSQLISRICHSHDEVFAVLMVIVAKVFLAYPQQAMWMM
TAVSKSSYPMRVNRCKEILNRAIHMKESLAKFVGDATRLTDKLLELCNKPVDGNNSTLSM
NIHFKTLKRLVEEHTFSEILIPLQSVMIPTLPSIPGTHANHDPFPGCWAYIAGFDDAVEI
LASLQKPKKITLKGSDGKSYIMMCKPKDDLRKDCRLMEFNSLINKCLRKDAESRRRELHI
RTYAVIPLNDECGIIEWVNNTAGLRNILIKLYKEKGIYMTGKELRQHMLPKSAPLSEKLK
MFKEVLLPRHPPLFHEWFLRTFPDPTSWYNSRSAYCRSVAVMSMVGYILGLGDRHGENIL
FDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTLRL
MRDQREPLMSVLKTFLHDPLVEWSKPVKGNTKAQVNETGEVVNEKAKTHVLDIEQRLQGV
IKTRNRIKGLPLSIEGHVHYLIQEASDDNLLCQMYMGWAPYM
NT seq 8229 nt   +upstreamnt  +downstreamnt
atgacaaaaacgaagctcagagtggactgtccccctcgcgtactctctctgcggttcaca
cctgtccatgacccctcgttttatccttttctctcccgaacgtgcgggactcgctgccca
ggcggggccacacgctcccgctcagcgcccgatcgcgtccctacggggatcccatcaaca
ccttccgtactttacacacgtaaacgttcgcaacagaaacgaataaaaagcaacatacgc
tcggaaagtaacaacaataacaaaaaagaaagtctgtatcttacacacgctgctcaccgc
taccttgctagtccagaggaatacaacacagttgtgcagaaaccaagacaaatactttgc
cagttcgttgacagaattcttacagaggtagatgttgttgccttggaactcattaagaaa
tcagattcacagccaagttctgtgatgttgcttgattttattcaacatatcatgaaatct
tccccacttatgtttgtaaatgtggatggaaatcaggaggaaactcaatgcagttgcatt
gaatttagtaactggatcataacaaggcttcttcgtattgctgccgctccaaactgcaac
acattgcacaagaacatctgtgatgtcatctgctctttactttttctctttaaaatgaag
agtggctccatttttgaagcactaactaaagacttgctacatctttttcaagacttaatc
atcttgcatgaaagagatgcacagaagcatccctggggagatggactggtctggccagtg
actgtagagagattttccagcaatatgagtgacaaagtgggatatttaagactggcccca
ttacagctgatgggtatgccaaatatagaatatttggaagttgtattaatgtctattctg
acaaatattgctgcagatatcttttttgtaagacaggatattattctctgggggataggc
tgctccgtgttagagtatggcagtccaaaagttaaaactttgacaatgaagtttatagtg
aagttaattcatttaggaggacctccagaacagctggccagtgttttcttctcagtcttt
tttgaaattctacagtcagcacttgaaatggatactgaggaatcagaactctttggagaa
cctctcttactgttggtgaggacattgctgccttttgaagcacattcttacaaaaatatt
gaacctgtctacttgaatatgctgctagagaagctctgctcatggtttgaaggggatgtg
tttaggtgccttcagtctgaaaagctgaaaaccgttttttgccacatgctgcagtatttt
ctggagtttgttccagctggctatgaatctgccttactaataagaaaggcccgtatcagt
accatatgtagaatttttgtgaatgtgcttggaactcaggaagaacaaaagtatctggtg
agtcctctttatacagcattaaaaacacaaactgaagaaatctttgaggagattcagcag
aaccagctggagagctcagatactgatgggtggagcagcagcagtgatgaagttccagag
aaaagacggagactgagcctacccacaaaacatccaaagaaatctcctgcacctttaata
cttagccctgtaaacatgaagctgaagagtgctctgtggaatgccatcactaagaaagct
gcatccttaatatctgtccttgaggaagaagttctgccaggggatgttctccaggctgtg
gaagggatcgctgtaattctgcgattggctgctctatgcatcgttcactgctctccccca
acagattccagcaggtaaaataaagaacatggagtgtctcatccatgtagctctgatacg
ggtaagaatactccaagctccttggattcaatggtgaatattcagttcaagtggatttcc
tctgattttaccacaagagtagtgaaagtctgcagaaacctgctagaggctgctacacag
attgttaatctagaacaagtgattgacagaatagtaaaaatcgttgatgctttgctatat
gctcaagtgaaaattccactgagtgatcagattcttgatgacttatgtggattgctgtct
ctgccctggatttacagccatcctgatgattcttcttttaagccatctatatgggggttt
ggtcctctagttttgagtcaaaaaactgcacagagtttctcaccccaaactcagtcacac
tgtgtgttccttctgactctcttcccaaaaaacattcatctagattggagaaaatcagtt
tatcactgggcattacaaagtcaccatgaaataattcgggctacttgtgttaaaggattc
tctctcctgcttcaacctgtgcagtcctgcagcgtgattcccagagctcttttaaatcaa
atcaaagatgagtctgagctagtcaaagaggcttgtgctgctatagttgggaagttatct
tgttgtctttctggtccattccacctccaaccttccttagcagactctgctgttaaggat
gttactcatgatattttgtgtagcagccttactgtgacttctgctcatggaaaaacctct
tctgtgcaagcctgtgttttcaagccctttttcattctacttgagagcaaagcacccagt
tcagtaaagctagcatttatagaaaatatacctcatctttgcaaacacctggattttaat
actgatgagtccagtgtgaagtctcttgttgggtctttattaaatctaatggaagatcca
gacaaagatgtaagagtggctttcagtaactgcataaagaacatactagaatccttagac
tctgaagaaggattcataaaagagctgtttgtttcaaggatgaaagaagcctacacaaat
gccaaaatgtcaagaaataatgagcttaaagacactttgattctcacaacaggagatatt
ggaagggcatccaaaggagaattggtgccatttgccctcctgcatttgttgcactgtttg
ttgtccaagtcgccttcggtggccggagcagcgtacacagagatccgggccctggcagca
gccaaggccataaagctgcaggcgtttttcagtcagtacaagaagccaatctgtcagttt
ctagtggaatctctgcactccagccagatggtggtgttgagtgctccatgccagggcaat
gagctgcagaaagaaacagctgctcaccagagagaaatggctctggacatgttatctgag
attgccagtgtatttgattttccagatctaaatcgctttctctcacggaccctgcaagtt
ttgcttcctgaccttgcagccaaggccagtcctgcagcctccacacttatcagaaccata
gcaaagcaattgaatgtgaacagaagagagattttaatcaataacttcaaatacatcttt
tctcatttggtctgttcctgcaccaaggatgagctggagcgggcactgcattacctcaag
aatgagactgagatcgagctgggcagcttgctgaggcaggactaccagggcctgcacaac
gaattgctgctgcggatcggggagcactaccagcaagtcttcaatggtctgtccatactg
gcttcatttgcctcccaggatgatccctatcagggacctaaggaaataacctcaccagaa
caaatggctgattatctgcaacctaaattgcttggtatcttggctttttttaacatgcag
ttactgagttccagtgttggcatcgaggataaaaaaatggctttaaacagcctgaggtct
ttaatgacactcatgggtcccaaacacatcagttctgtcagagtgaagatgatgaccacg
ctgagaacagctctgagatacaaggatgacttcccagaactgtgctgcagagcctgggat
tgctttgttcgaagtctggaccattcctaccttggctccttgctcagccaggtgatagta
gtgcttttgcccctcatacatatccaacccaaggaaaccacagcaatattccacttcctc
atagtggagaacagggatacagtacaagactttctacatgaaatatattttctacctgac
cttcctgaactcaaagaagttcaggttgtccttcaggaatacagaaaggaatcctccaaa
agcacagacttgcagacagccctgcagctgtctatgagagctattcagcacgagaatgtg
gatgttcggattcatgcacttaccagcctgaaagaaacattgtatagaaaccaggaaaaa
ctgatcaagtatgtcacagacagtgaaaccgtggagccagtcatctcccagctggtgaca
gtgcttctcattggctgccaggatgccaattcccaagcacgactgctctgtggagaatgt
ttgggtgaactgggagccatagatcctggcaggcttgatttttcaacaagtgaaactcaa
ggaaaacacttcacttttgtggctggagtggaagattcaaattttgcctatggattatta
atggaactgaccagagctttccttgcttatgctgacaatgttcgtgctcaggattctgca
gcgtatgcaattcaggagttactgtccatctatgactgtagagagacaaacactgactgc
cctggctccaggctttggaggaggtttcctgagcatgtgcaggagatcttggaacctcac
ttaaacacaaggtacaagagttatcagaaggctgtaaactggtctaaggtgaagaagcca
atttacttaagcaaattaggtgataattttgcagaatggtcagcaacttgggcaggttat
cttataacaaaggtgcgacatgatcttgccagaaaagtctttgattgctgcagtattatg
atgaaaaatgactataaagtgacaatttatttgcttccacacatccttgtctatgttttg
ttgggatgcagtcaagaggatcaacaagaggtttacatggagatcatggctgttctgaca
cacgatgaccagtgcagcaggaggctcgaggacagcgcatctgacctgagccagctgagc
acacagacagtgttctccatgctggatcatctcactcagtgggccagacataagtttcaa
acactcattgctgagaaaaatgctggcaagtctagcaaagacagaagtgatctaaaaaca
tcaagtgaggactatggagaatatcaaaatgtgacacgttttctagacctcattccccag
gatacactggctgtagcctcctttcgttccaaggcttacaccagggctgtgatgcacttt
gaatcatttataactgagaagaaacaaaatattcaagaacatcttggatttcttcagaaa
ttgtatgctgctatgcacgagccagatggagtggctggggtgagcgccattcggaaggca
gagccatctctcaaagaacaaatccttgagcatgaaagtattggcttgttaagagatgca
acagcctgctatgatagggctatccaactggaacctgatcagatcattcactatcatggt
gcagtgaagtccatgttaggccttggtcagttgtctgctgtaataactcaggtcaatgga
gtgcttgcaaacaggtctgaatggatttctgagttgaacacttacagagtggaagcagcc
tggaaactatcacaatgggatttactggaaaattatttggcttcagatgtgaagtccact
acttggagtgtcagactgggacatttgttgttatcagccaagaagaaaaatgaagcagct
ttttacgagacactcaaggttgttcgagcagagcagattgtgcccctctcagcagcaagc
tttgaaagaggatcctatcagcgaggatatgaacacattatcaggttgcatatgctgtgt
gagttggaacacagtattgggccaatgtttcagcaagcggatggtgaccacagtagagat
tccctgaactggtgtgctcggattgaaatgacccaaaactcttacagagcaaaagaaccc
attttagcactgagaagggctttgcttagtctcagtaaaagccaggattacagtgagctg
gttggacagtgttggctccagagtgccagagttgcaaggaaagctgggcatcaccagact
gcctataatgctctgctcaatgccggggaatcaacactctcagaactttatgtagaaaga
gcaaagtggctctggtccaagggtgaagttcatgaagcactaattgttctccagaaggga
gttgagttatgtttccctgaaaataaagcaccctgcagtagcaaaaatcagctcatccat
ggtcgggcaatgctgctggtgggcagatttatggaagaaactgctaactttgaaagcaat
gcagtcatgaaaaagtataaggatgttacagttttcttaccagaatgggaagatggacat
ttttatcttgcaaaatactatgataaattaatgccgatggtaactgacaacaagatggaa
aaacaaggagatctgattagatacatagttcatcactttgggaggtctctacagtatgga
aaccaattcatttatcagtcaatgccaagaatgctgtctttatggctggactttggagca
aaagcatatgaatgtgataaagcaggtcgttcagaacgtgttcaaatgaaaaatgatctg
gctaaaataaacaaggtgattacagagcacacaaatcacctggcaccttaccagttcctg
acagccttctctcagctcatctcccgaatctgccattctcatgatgaagtctttgcagtt
ctgatggtgattgttgctaaggtgtttttagcctatccacaacaagcaatgtggatgatg
actgctgtgtccaagtcctcttaccctatgcgagtcaatagatgcaaggaaattctaaac
agagctattcacatgaaggaatctctagcaaaatttgttggagacgccacacgccttacg
gacaagctgctggaactctgcaacaaaccggttgatggaaacaactcaacattaagcatg
aatattcatttcaaaacactgaaaagattagtagaagagcacaccttcagtgaaattctc
attcccttacaatctgtaatgataccaactcttccctcaattcctggtacccatgctaac
catgacccttttcctggctgctgggcctacattgcaggctttgatgatgcggtggaaatt
cttgcctcgcttcaaaaaccaaaaaagatcaccttgaaaggttcagatgggaaatcttac
attatgatgtgcaagccaaaagatgatctgagaaaagactgtcggctcatggaattcaac
tcccttattaataagtgcttaagaaaagatgcagagtcccgtaggcgagagctccacatc
cgcacctacgcagtgattccattaaatgatgaatgtggcataattgagtgggtgaataac
actgctggtctaagaaatatcctgataaaactttataaggaaaaaggtatctatatgact
gggaaagaactgcggcagcacatgcttcccaagtcagcacctttgtctgaaaagctgaaa
atgttcaaagaggtccttctgcctcgtcaccctcctctctttcatgaatggtttcttaga
acatttcctgatcctacttcatggtacaacagcaggtcagcctactgccgctccgttgcc
gtcatgtccatggtgggctacatcctggggctgggggaccgccacggcgagaacatcttg
tttgattctttcactggggagtgcgtgcacgtggatttcaactgccttttcaataaggga
gaaacttttgaagttccggaaatcgttcctttccgcctcacccacaacatggttaatggg
atgggccccatgggaactgagggtctcttccgaagagcctgtgaagtcaccctgaggctg
atgcgggatcagagggagcctctgatgagtgtcttaaagacttttctccacgatcctctt
gtggaatggagtaaacctgttaaagggaatacaaaagcccaggtgaatgaaactggagaa
gttgtcaatgaaaaggccaaaacccatgtccttgatatagagcaacggctgcaaggggtc
attaagactagaaacagaatcaaaggattacctttatctattgaagggcatgttcactac
ctcattcaagaagcaagtgatgacaacctgctctgccagatgtacatgggctgggctcca
tatatgtga

DBGET integrated database retrieval system