KEGG   Geospiza fortis (medium ground-finch): 102032251
Entry
102032251         CDS       T03755                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04080  Neuroactive ligand-receptor interaction
gfr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102032251 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102032251 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gfr04030]
    102032251 (LPAR2)
G protein-coupled receptors [BR:gfr04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102032251 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 102032251
NCBI-ProteinID: XP_014166980
UniProt: A0A6I9ZCI2
LinkDB
Position
Un
AA seq 221 aa
SWLDTSLTASVVNLLAIAVERHRTVLTMQLHSEMSAQRVVGLIFSIWAAALLLGLIPSYG
WHCLCSLESCSRMAPLYSRSYLTFWSLIGLVIVILPGLVIIGWVIVIIVEGLTGDTIMAL
VKTVTIILGAFVVCWTPGQVLLLLDGLGCASCDVLAVEKYVLLLAEVNSLINAVVYSWRD
NEMRSTFRRLLCLPCPRHAKYAAPERGLSSHNGHFTVDSSI
NT seq 666 nt   +upstreamnt  +downstreamnt
agctggctggacaccagcctgacggcgtcggtggtcaacctgctggccatcgcggtggag
aggcaccggacggtgctgaccatgcagctgcacagcgagatgtcggcgcagcgcgtggtg
gggctgatcttctccatctgggcggcggcgttgctgctggggctgatcccgtcctacggc
tggcactgcctgtgctccttggagagctgctccaggatggcgccgctctacagccgtagc
tacctgaccttctggagtttaattgggttggtcatcgtcatcctgcctggcttggtcatc
attgggtgggtcatcgtcatcattgtggaagggctcaccggcgacaccatcatggcgctg
gtcaagaccgtcaccatcatcctgggagccttcgtggtgtgctggaccccgggccaggtg
ctcctgctgctggacgggctgggctgcgcgagctgcgacgtgctggccgtggagaagtac
gtgctgctgctggccgaagtcaactcgctcatcaacgccgtcgtttactcgtggcgcgat
aacgagatgaggagcaccttccgccgcctcctgtgcctgccgtgcccccgccacgccaaa
tacgccgcgccggagcgggggctgagctcccacaacggccacttcaccgtggattcttcc
atttag

DBGET integrated database retrieval system