KEGG   Geospiza fortis (medium ground-finch): 102032321
Entry
102032321         CDS       T03755                                 

Gene name
TP53I3
Definition
(RefSeq) quinone oxidoreductase PIG3
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102032321 (TP53I3)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     102032321 (TP53I3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 RRM_1 ADH_N RRM_5
Other DBs
NCBI-GeneID: 102032321
NCBI-ProteinID: XP_005418540
LinkDB
Position
Un
AA seq 458 aa
MFAAYFDCPGGPENLYMKEVMKPNPGEGEVLVKVSASALNRADLLQRRGKYPPPKGASDI
LGLEAAGSVAGLGPGCSGRWRIGDAVMALLPGGGQAQYVTVPEGLLMPIPKDMTFIQAAA
IPEAWLTAFQLLHFVGKVQEGERVLIHAGASGVGMAAIQLVRLAKAIPIVTAGTQEKLEA
TANAGAAAGFNYKNEDFSEKVLEFTQGSGVDIILDCVGSSYWEKNLNCLSTDGRWIIYGL
LSGGEVHGDLLARLISKRASIHTSLLRSRDKEYKERLVRAFTEEVLPHFSGGASPRLQPL
VDSVYPLHAIAEAHRAMEENRNIGKIVIEIPVCGKKGPPQCGKIRLPPEVNRILYIRNLP
YKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYL
VVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgtttgcagcctattttgattgcccaggaggcccagaaaatctctatatgaaagaagtg
atgaaaccaaatccaggagaaggagaagttcttgtgaaggtctctgccagtgctctgaat
agggctgatttactccagaggagagggaagtaccctccccccaaaggagcaagtgacatt
ttaggcctggaagcagctgggagcgtggccgggctgggtcccggctgctcgggccgctgg
aggatcggcgatgcagtgatggctctgctccctggggggggccaggcacaatacgtgaca
gtgcccgaaggcctcctgatgccaattcccaaagacatgacttttatccaggctgcagcc
attcctgaagcctggctaacagcatttcagctgctccattttgtaggtaaagtacaggag
ggtgagagagtgttgatccacgctggagccagtggggttggcatggcagccattcagctg
gtgagactggccaaggccattcccattgtgacagcaggaactcaggagaaactggaagca
acagcaaatgctggagcagctgcagggttcaactacaagaatgaagacttcagtgaaaag
gtcttggagttcacccaaggttctggagtagatattattttagattgtgttgggtcctca
tactgggagaagaatctcaactgtctgagcactgatggccggtggatcatttatggattg
ctgagtggaggtgaagtccatggggatttgctggcaaggctgatttccaaaagagccagc
atccacacaagcctgttgcggtctcgagacaaggagtacaaggagcgcctggtgagagcc
ttcacagaggaggtgctgccccatttctccggaggagcttccccgcggctgcagcccctc
gtggacagcgtttacccactgcatgccatcgctgaggcgcacagggctatggaggagaac
aggaacatcggcaaaatcgtcatcgaaattcccgtttgcggcaagaaggggccgccgcag
tgtggtaaaatccggctccctccggaggtcaaccggatcctgtacatcaggaacctgccg
tacaaaattacggccgaggagatgtacgacatttttgggaagtacgggcccatccggcag
atcagagttgggaatacccctgagaccagaggaacagcctacgtggtgtatgaggacatc
ttcgatgccaagaacgcctgtgaccacctgtcagggttcaacgtgtgcaacagatacctc
gtggtgctgtactacaatgccaacagggcattccaaaagatggacacaaagaagaaagaa
gaacagcttaagcttctcaaggaaaaatatggaattaacacagacccaccaaaataa

KEGG   Geospiza fortis (medium ground-finch): 102035365
Entry
102035365         CDS       T03755                                 

Gene name
EI24
Definition
(RefSeq) EI24, autophagy associated transmembrane protein
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102035365 (EI24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 102035365
NCBI-ProteinID: XP_005431726
UniProt: A0A6I9HVS0
LinkDB
Position
Un
AA seq 343 aa
MADSVRIFLHDLVRGIKDSIWGICTISKLDARIQQKREEQRRRRANSALAQRRFHMEEKK
QENEPRIVSRIFQCCAWNGGVFWLSLFLFYRVFIPVLQSVTAQIIGDPSLHGDVWSWLEF
ILTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLIQGMIVSLFPIDLIGQLISLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEARTPGKTYHFQLRLFSLVVFL
SNRLFHKTVYLQSALSGASSSPSSSSSSSSSPSPAKHAAAPGH
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggctgacagcgtgagaatcttccttcatgacctcgtcaggggaattaaggactccatc
tggggcatctgcaccatctccaagctggatgcccggatccagcagaaaagggaagagcag
aggcggaggagagccaacagtgcactcgcccagaggaggtttcacatggaagagaagaag
caagagaatgaaccccggatagtgagccgcatatttcagtgctgtgcctggaatggaggt
gtcttctggcttagtctcttcttgttctaccgagtgttcatccccgtccttcagtcggtc
acggcgcagatcatcggtgacccttccttacatggagacgtctggtcctggctggagttc
atcctcacctccattttcagcgctctctgggtcctgcccctctttgtgctcagtaaggtg
gtcaatgccatctggtttcaggacattgcagacctggcgttcgaagtgtcgggcaggaag
cctcaccccttccccagcgtcagcaaaatcatcgctgacatgttgttcaacctcctgctg
caggcacttttcctcatccagggaatgatcgtgagcctgttccccatcgacctcattggg
cagctgatcagcctcctgcacatgtcactgctctactcgctctactgcttcgagtaccgc
tggttcaacaaaggaattgaaatgcaccaacggttgtccaacatcgagaggaactggccc
tactacttcggctttggcttgcctctggcatttctcacagccatgcagtcctcctacatc
atcagcggttgcctcttctccatccttttccctctcttcatcatcagcgccaacgaagcc
aggacccccggcaaaacctaccacttccagctccgtctcttctccttggtggttttcctc
agcaacagactcttccacaagaccgtttaccttcagtccgccctgagcggtgcttcctcc
tccccctcctcctcctcctcctcctcctcctcgccctctcctgccaaacacgcggctgct
ccggggcactga

DBGET integrated database retrieval system