KEGG   Geospiza fortis (medium ground-finch): 102032374
Entry
102032374         CDS       T03755                                 

Definition
(RefSeq) sestrin-3-like
  KO
K10141  sestrin 1/3
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102032374
SSDB
Motif
Pfam: PA26 CMD Leptin
Other DBs
NCBI-GeneID: 102032374
NCBI-ProteinID: XP_005419920
LinkDB
Position
Un
AA seq 439 aa
MSSSDPECPQFLFVKVLASRGRLEAVTQQMGYHPQYLDSFLKMQHYLMHMDGPLPFDCRH
YIAIMAAARHQCRYLVNLHVLQFLRAGGDPQWLRGLEFIPPKLRNLNEINKILAHRPWLI
TKEHIEKLLKISEWSWSLAELVHAVVLLAHCHALASFVFGCGCEQDEGLGGRGSLKPLSL
GNQCFCEATASNSYGQELLRINRKRSLDSCMELDSLRERMQRIHVETEGRDEMRLLQQDR
EEDTDGEVTGATNLACYMQDPDFGYQDFARRDEDQTQVFRVQDYSWEDHGFSLVNRLYSD
IGHLLDEKFRMVDGLQSSAMAKRQGCEPSVFKRGIWNYIHCMFGIRYDDYDYAEVNQLLE
RMLKVYIKTVTCYPEKTNSEMFDRFWKQFKHSEKVHVNLLILEARMQAELLYALARQPPL
SLDSCGTLTLGPTARDSLI
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtccagcagcgaccctgagtgcccccagttcctctttgtgaaggtgctggcaagccga
gggcggctggaggcggtgacccagcagatgggataccacccccagtacctggacagcttc
ctcaagatgcagcactacctgatgcacatggacggccctctgccctttgactgccggcac
tacatcgccatcatggcagcagcccggcaccagtgccgctacctggtgaacctgcacgtg
ctgcagttcctgcgggcagggggggaccctcagtggctgcgcggcctcgaattcatcccc
cccaaactccgcaacctcaacgagatcaacaagatcctggcacaccggccgtggctcatc
accaaggagcacattgagaagctgctgaagatcagcgagtggagctggtcactggcagag
ctggtgcacgccgtcgtcctcctggcacactgccacgcacttgccagctttgtcttcggc
tgtggctgcgagcaggacgaggggctggggggccgaggctcgctgaagccactgtcactc
gggaaccagtgcttctgtgaggccactgccagcaacagctacggccaggagctgctgcgc
atcaaccgcaagcggtccctggactcctgcatggagctggattccctccgggaacgcatg
cagcggatccatgtggagactgagggcagggatgagatgaggctgctgcagcaggaccga
gaggaagacactgatggggaagtcaccggtgccaccaaccttgcatgctacatgcaggac
cctgacttcggataccaagactttgcccggcgtgacgaggatcagacgcaggtgttcaga
gtccaggattactcctgggaagaccatggcttctcactggtcaaccggctgtactctgac
attgggcatctcctggatgagaagtttaggatggtggatggtctgcagagcagtgccatg
gccaagcggcagggctgtgaaccctctgttttcaagcggggcatctggaactacatccac
tgcatgtttggcattaggtacgatgattatgactatgcagaagtgaatcagctcctggag
cgaatgctcaaagtttacattaaaactgtaacctgctacccagagaagacaaactcagaa
atgtttgacaggttctggaagcagttcaagcacagtgaaaaggtccacgtgaacctgctg
atcctggaagcccggatgcaggcagagctgctgtacgcgttggcccggcagcctcctctg
tccctggactcgtgcgggaccctcacgctgggaccgacggcgagggattccttgatttag

KEGG   Geospiza fortis (medium ground-finch): 102032819
Entry
102032819         CDS       T03755                                 

Gene name
SESN3
Definition
(RefSeq) sestrin 3
  KO
K10141  sestrin 1/3
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102032819 (SESN3)
SSDB
Motif
Pfam: PA26 CMD PEX11 KIP1
Other DBs
NCBI-GeneID: 102032819
NCBI-ProteinID: XP_005417785
UniProt: A0A6I9HDY5
LinkDB
Position
Un
AA seq 433 aa
MQANGLDERTNLLVEEYSTSGRLDNITQVMSIHTQYLESFLRSQFYMLRMDGPLPLPYRH
YIAIMAAARHQCSYLINMHVDEFLKTGGIAEWLNGLEYIPQRLKNLNEINKLLAHRPWLI
TKEHIQKLVKTGENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDPDTSNGVRLIAV
NNFCVCDLANDNNIENASLTSSNFGIADSLSELEALMERMKRLQEDKEDEEASQEEMATR
FEKEKKESLLVISGAFDDEIVSTDVSRYVEDPGFGYKDFARRGEDHLPTFRAQDYTWENH
GFSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTTLRRALFNYVHCMYGIRYDD
YDYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAE
LLYALRAITRHLT
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgcaagcaaacggtttggatgaacgtactaatcttcttgtggaagaatattctacgtct
ggtcgcctggacaacatcacccaggtcatgagcatccacactcagtatctggagtctttc
ctccgcagccagttctacatgctgcgcatggatgggccccttcctctgccctacaggcac
tacattgctatcatggctgctgccagacatcagtgttcctacctaataaatatgcacgtt
gatgagtttctgaagactggtgggattgcagagtggttgaatggtttagaatacattccc
caaagactgaaaaacctgaatgaaataaacaaacttcttgcacaccggccctggctgatc
acgaaagagcacatccagaaacttgtcaagactggagaaaataattggtctcttcctgaa
ctggttcatgctgttgtcctgttggcccattatcatgccttggcaagttttgtgtttggt
agtggcattaatccagagagagatccggatacatccaatggagtcagacttatagcagtc
aacaacttctgtgtctgtgatcttgccaatgacaacaacatagaaaatgcatccctcaca
agtagcaactttgggattgcagattctttaagtgagctggaggccctgatggaaaggatg
aagagactacaagaagataaagaggacgaagaagcctctcaggaagaaatggcaactcgc
tttgagaaggagaagaaggagagtctgctagtaattagtggagcatttgatgatgaaata
gtttctacagatgtctcccgttatgttgaagatcctgggtttgggtacaaagactttgca
aggcgaggagaagaccatctgccaacattcagagctcaggactatacttgggaaaatcat
ggcttttcccttgtaaacaggctttattctgatattgggcatctcctggatgagaagttt
cggatggtgtataacctcacatataacactatggcaacacatgaagatgttgatacaact
acactaagaagagctttatttaactatgtccactgtatgtatggaatcaggtatgatgac
tatgattatggagaagtgaatcagctacttgaacgcagcctgaaggtttacataaagaca
gtgacctgctacccagagagaaccaccaagcgcatgtacgacagctactggcgccagttc
aagcactcggagaaggttcatgtcaatctacttctgatggaagctcggatgcaagccgaa
cttctgtatgcccttcgtgccataactcgtcacttaacctga

KEGG   Geospiza fortis (medium ground-finch): 102035838
Entry
102035838         CDS       T03755                                 

Gene name
SESN1
Definition
(RefSeq) sestrin 1
  KO
K10141  sestrin 1/3
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102035838 (SESN1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 102035838
NCBI-ProteinID: XP_005418474
UniProt: A0A6I9HES4
LinkDB
Position
Un
AA seq 481 aa
MLSKRCPFPDVREKSEAILSGVQELGIRIPRPLGHGPSRFIPEKETIQVGKEDATMHTLF
AESFATLGRLDNVTLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCS
YLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKMLAHRPWLITKEHIEQLLKTEE
NSWSLAELIHAVVLLTHYHSLASFTFGCGISPEIDCEGGHTFRPPSVSNYCICDITNGYH
GVEEIHASPAGSIPSTESVCEVEALMEKMKQLQECRDEEEASQEEMATRFEREKRESMFV
CSSEDEESAATRDVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYSWEDHGYSLVNRLYPDV
GQLLDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQLLDR
SFKVYIKTVVCTPEKTTKRMYDSFWRQFEHSEKVHVNLLLVEARMQAELLYALRAITRYM
T
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgctgtccaagcggtgccccttccccgacgtgagggagaagagcgaggcgatcctcagc
ggggtgcaggaacttggaataagaattcctagaccactgggacacggaccaagcagattc
atccctgagaaggagacaattcaggtgggaaaggaggacgccacgatgcacacactgttt
gcagagtcttttgccacgctgggccggctcgacaatgtcaccttggtgatggttttccac
ccacagtatctggaaagctttctcaaaactcagcactatctgctgcagatggatggcccg
ctcccgctccactaccggcactacatcggcatcatggctgcagcacgacatcagtgctct
taccttgttaacctccacgtgaatgacttccttcatgttggtggagaccctaaatggttg
aatggtctagaaaatgcacctcaaaaactgcaaaatttaggagaactgaacaaaatgttg
gctcaccgaccctggcttatcaccaaggaacatatcgagcaacttctgaagacagaagag
aacagctggtccctggcagagctgatccatgcagtcgttctccttacacactaccactcc
cttgcttccttcacgtttggctgtgggatcagcccagagatcgactgtgaagggggtcac
accttcaggcccccctctgtcagtaactattgcatctgtgatataacaaatggctaccac
ggggtggaggaaatccatgccagcccagctggaagcattccatccacagagtctgtctgt
gaagttgaagctcttatggagaagatgaagcagctgcaggagtgcagagacgaagaggaa
gccagccaagaagagatggccacacgttttgaaagagagaagagagaaagcatgtttgtg
tgctcttcagaagatgaagaatctgcagcaacaagagatgtgtctcggcactttgaggac
accagctatggttacaaagacttctcccgacacggaatgcacgtgcccacctttcgtgtt
caggattattcctgggaagaccatggctattccttggttaatcgtctttatccagatgtg
ggacaactacttgatgagaagttccatattgcttataatctgacttacaacacaatggcc
atgcacaaagatgtggatacctcaatgctaagacgagctatttggaactatattcattgt
atgtttggaataagatatgatgattatgactatggtgaaattaatcagttgttggaccgc
agctttaaagtttatatcaagactgtggtttgcactcctgaaaagaccacaaaaagaatg
tatgatagcttctggagacagtttgaacactctgagaaggtccatgtaaatttgcttctg
gtagaagctcggatgcaagccgaactactttatgctctgagagctattactcgctatatg
acctga

KEGG   Geospiza fortis (medium ground-finch): 102037166
Entry
102037166         CDS       T03755                                 

Gene name
SESN2
Definition
(RefSeq) sestrin-2
  KO
K20394  sestrin 2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    102037166 (SESN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102037166 (SESN2)
SSDB
Motif
Pfam: PA26
Other DBs
NCBI-GeneID: 102037166
NCBI-ProteinID: XP_005427133
LinkDB
Position
Un
AA seq 335 aa
MGLHPQYLSSFWKTQYLLLRMDGPLPYHKRHYIAIMALLRPGQDSWSLAELVQALVLLTH
YHSLASFVFGCGIGPEGEQDLGSSCWPPSPHSNRSPASGDSMGGSGGTDAMQEVEVLMER
MKLLQENQLEEEGVTQEEMATRFELEKTESLLVPSSDILDPSLQSNIRCFLEDPEFGYKD
FTRRGEQAPPTFRAQDYTWEDHGYSLINRLYPDVGQLLDEKFQVVYNLTYNTIAMHCGVD
TSVLRRAIWNYVHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPERTTKQIYAQFWR
HFKHSEKVHINLLLLEARMQAALLYALRAVTRYMT
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggggctgcacccccagtacctcagcagcttctggaagacccagtacctcctgctgcgc
atggacgggcccctgccctaccacaagcgccactacatcgccatcatggctctgctgagg
ccggggcaggacagctggtcactggcagagctggtgcaggcgctggtgctgctcacccac
taccactcgctggcatcctttgtcttcggctgcggcatcggccccgagggggagcaggac
ttgggcagcagctgctggcccccctcaccccacagcaacaggagccctgcctctggggac
agcatggggggctctgggggcacagatgccatgcaggaggtggaggtgctgatggagagg
atgaagctgctgcaggaaaaccagctggaggaggaaggagtcacacaggaggagatggca
acacgcttcgagctggagaagacagagagtttgctggtcccttcctcagatattttggat
ccctccctgcagtccaacatccgctgcttcctggaggaccctgaattcggatacaaggac
ttcacacggaggggggagcaggccccccccactttccgtgcacaggattacacctgggag
gaccacggctactcgctgatcaaccgcctgtacccagacgtggggcagctcctggatgag
aagttccaggtggtttacaacctgacctacaacaccattgccatgcactgcggcgtggac
acctccgtgctgcgccgtgccatctggaactacgtgcactgcgtcttcggcatccgctat
gatgactacgactacggggaggtgaaccagctcctggagcgcaacttaaaggtctacatc
aagacagtggcctgctacccagagaggacaaccaagcagatctatgcacagttctggagg
cacttcaagcactcggagaaggtgcacatcaacctgctcctgctggaggcacgcatgcag
gcagctctgctctacgccctcagggccgtcacccgctacatgacctga

DBGET integrated database retrieval system