KEGG   Geospiza fortis (medium ground-finch): 102032732
Entry
102032732         CDS       T03755                                 

Gene name
GORAB
Definition
(RefSeq) golgin, RAB6 interacting
  KO
K19748  RAB6-interacting golgin
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102032732 (GORAB)
Membrane trafficking [BR:gfr04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    102032732 (GORAB)
SSDB
Motif
Pfam: Transcrip_act
Other DBs
NCBI-GeneID: 102032732
NCBI-ProteinID: XP_014164807
LinkDB
Position
Un
AA seq 364 aa
MNMEERGRLRGQRLDLYEPSPSAGQQQQPRPQAVPKTRKQLQREKALPQQSQRXGXXXSV
TPEQLLSAPQAKPGDPQQPGPAPGDERQRDSREQQEGGTAAESCNGSDSAQPRPAKPSSQ
VERKKVELQEKSRWEILQQEQRLIEEKNKRKKALLARAIAERSKRTQAETVKLKRIQKEL
QALDEMVSADIGILRNRIDQASLEYSYARKRYDKAESEYVAAKLELQHKTELKEHLTEHL
CTIIQQNELRKARKLQELMQQLDVEADEENLELEIEVEQMLQQQEAEAGRQSNQAHSHAG
TAQESPAPSGVGQESQQVDHAAAAASPAVSEQSQNPRTKSLSNVDSQTQAVNVTSGSSPA
CSAT
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgaatatggaggagcgggggcggctgcgggggcagcgcctagatctgtacgagccctca
ccctcagcggggcagcagcagcagcctcgcccccaggccgtgcccaagactcggaaacaa
ttgcaacgggaaaaagccctcccgcagcagagccagaggncgggnnnnnnnnnntctgtc
actccagagcagctgctctctgctccacaagccaaacctggtgacccccagcagcccggg
ccagctcctggggacgagaggcaaagggacagccgggagcagcaggagggagggacagcg
gcagagagttgtaatggcagtgacagcgcccagccccgccctgcaaagcccagcagccag
gtggagagaaagaaagtggaattgcaggagaaatcgcggtgggagatcctgcagcaggag
cagcggctgatagaggagaagaataaacgcaagaaggcactgctggccagagccattgct
gagagatccaaaagaacccaggctgaaacagtgaagctgaagaggattcagaaggagctg
caggctctggatgagatggtgtctgctgacatcggcatcctgaggaaccgcatcgaccag
gccagcctggaatactcctatgcccggaagcgctacgacaaggccgagtccgagtacgtg
gcggccaagctggagctgcagcacaagacagagctcaaggagcacctgacagagcacctg
tgcaccatcatccagcagaacgagctccgcaaggccaggaagctgcaggagttaatgcag
cagctggacgtggaggcagatgaggaaaatctggagctggagatcgaggtggaacagatg
ctgcagcagcaggaggcagaagcagggagacaatccaaccaggctcacagccatgctggg
acagcccaggagagccctgctcccagtggtgtggggcaggagagccagcaggttgaccat
gctgctgctgctgcttctcctgcagtttctgaacagtctcaaaaccccaggaccaaatcc
ctctccaacgtggacagccaaactcaggcagtaaatgtgacttcaggaagctccccagct
tgttctgccacatga

DBGET integrated database retrieval system