KEGG   Geospiza fortis (medium ground-finch): 102033034
Entry
102033034         CDS       T03755                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04060  Cytokine-cytokine receptor interaction
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr05164  Influenza A
gfr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102033034 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102033034 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102033034 (FAS)
   04217 Necroptosis
    102033034 (FAS)
   04115 p53 signaling pathway
    102033034 (FAS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102033034 (FAS)
   05168 Herpes simplex virus 1 infection
    102033034 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:gfr04050]
    102033034 (FAS)
   04090 CD molecules [BR:gfr04090]
    102033034 (FAS)
Cytokine receptors [BR:gfr04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102033034 (FAS)
CD molecules [BR:gfr04090]
 Proteins
  102033034 (FAS)
SSDB
Motif
Pfam: TNFR_c6 Death SCF Insulin_TMD DUF4381
Other DBs
NCBI-GeneID: 102033034
NCBI-ProteinID: XP_005417444
LinkDB
Position
Un
AA seq 361 aa
MKEREQVALLIIETECKNDTEALITSSRRIISRREVNCKEDEYSSDNQCCKKCRSGFVKN
VSCPTDVTKHCAPCQKGKEFMNHPNDLDKCLRCKLCDSNFGWEVVKNCTPEEDTQCDCAK
NHFCNHTRCDACSPCTICGSGVIEKQCTRDSDTVCGMKDPATLWWIALVALVALVLLAIA
GAIVWYKKKQKHLTINTGLPGNGVYKGEHVHSFPFLLLDVDLSSHIPGIVAEMTLTEVKK
FVRHHHVSEPAIDQSIQDFPGDTSEQKIRLFRVWYQSHGMKGAYGTLIRSLRELKMCAVA
DKIEQKLKAAISSSQEGGQSYNPDSEQSKTCTQEGRNSYNESAELSKASTASLEETLHRV
T
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaaggagagggagcaggtggctctcctaattattgaaacagagtgcaaaaatgatact
gaagctctaataacatccagtaggaggatcatttccaggagggaagttaactgcaaggag
gatgaatacagttcagataatcagtgttgcaagaaatgtagaagtggttttgttaaaaat
gtctcctgcccaacagatgttaccaaacactgtgctccatgtcagaaaggaaaggaattc
atgaatcaccccaatgacttagacaagtgtttgagatgcaaattgtgtgacagcaacttt
ggttgggaagttgtaaagaactgtaccccagaagaggacacacagtgtgactgtgcaaag
aaccatttctgcaatcatacacgatgtgacgcttgcagtccatgtaccatatgtggaagc
ggtgtaattgaaaagcaatgtactagagattcagacactgtgtgcggaatgaaagatcca
gcaacactgtggtggattgctttggtagctttggtagctttggtactactggcaatagct
ggagcaatagtctggtacaagaaaaaacagaaacatcttacaatcaatacgggcctccca
ggtaatggggtttacaaaggagagcatgtgcattcatttcctttcctgctcctagatgtt
gacctgagcagccacattcctggcattgtggcagagatgacactcacagaagtcaagaaa
ttcgttcgtcaccaccatgtatcagaacctgccatagaccaaagcattcaggattttcct
ggtgatacatctgaacagaagattaggctgtttcgagtctggtaccaaagtcatgggatg
aagggagcctatggaaccctaataagaagcctgagagagttaaaaatgtgtgctgtagct
gataaaattgagcaaaaactgaaggcagctatttccagctctcaggaagggggacagtct
tataatcctgacagtgagcaaagcaaaacttgcactcaggagggtagaaactcttacaat
gagagtgctgagctaagtaaagcctctactgctagtttggaagagaccttgcacagagta
acttga

DBGET integrated database retrieval system