KEGG   Geospiza fortis (medium ground-finch): 102033184
Entry
102033184         CDS       T03755                                 

Gene name
ADGRB1
Definition
(RefSeq) adhesion G protein-coupled receptor B1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102033184 (ADGRB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gfr01002]
    102033184 (ADGRB1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gfr04131]
    102033184 (ADGRB1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gfr04030]
    102033184 (ADGRB1)
Peptidases and inhibitors [BR:gfr01002]
 Mixed peptidases
  Family P2
   102033184 (ADGRB1)
Membrane trafficking [BR:gfr04131]
 Endocytosis
  Phagocytosis
   Others
    102033184 (ADGRB1)
G protein-coupled receptors [BR:gfr04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   102033184 (ADGRB1)
SSDB
Motif
Pfam: AGRB_N TSP_1 GAIN TSP1_spondin 7tm_2 TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 102033184
NCBI-ProteinID: XP_014166134
LinkDB
Position
Un
AA seq 1466 aa
MGTAQTKPGDGVSLGIGTPQTKPGDLGMGTDQCTTLVQGKFFGYFSSFAVFPLNSSLCSW
IIQNPDPRRYTLYMKILKPSGVCDHQHIRTYQFDSFLESTRTYLGMESFDDVLKLCDGST
RFAFLQSNKQFLQMKQTAPPGVDTWPMRWKPTKAQERDFSVEYLVVGNRNPSKAACQMLC
KWLDACLAISSSSHPCGIMQTPCSCSGGEVLDQASEILGFTRKKEDCYKDGIYLENCVSS
PKDSNGAEGGSGGWNSWSAWGDCTKDCGGGLQTRMRSCKPLPNEGLACEGVLEEGRLCNR
KACNTNGRYNSRSQSLRSTDNRKREDPDELQHYGYPAPQIGDPAAEEWSPWSVCSTTCGE
GWQTRTRFCVSSSYSTQCSGPLREQRQCNNSAVCPVHGTWDEWSPWSLCSSTCGRGYRDR
TRTCKPPQFGGNPCEGPEKQTKFCNIALCPGRDMDGNWNEWSSWSSCSASCSNGTQQRTR
ECNGPSYGGAECQGHWVETRDCFLRQCPVDGKGQAWGVWGSCTATCGGGTQRRDRVCYGP
FFGGETCQGPKEEYKQCNDRKCPEPHEICDEESLGPVVWKETPAGDAAAVRCPRNATGLI
LRRCILDEEGIAYWEPPTYIKCVSIDYRNIQMMTREHLAKAQRGLMGDGLSDVLQNLVEI
SQDGTSYSGDLLSTMDVLRNMTEIFRRAYHSPTSGDVQNFVQILSNILSEENREKWEEAQ
LIGPNAKELFRLVEDFIDVIGFRMKDFRDSYQVTDNLVLGIHKLPANAATDITFPMKGWR
GMVDWAKNSEDKVTVSKSILSSGLSVSDDSSVFVVGTVLYRNVGNILSLQRNSTVLNSKV
ISVTVKPFPRSLLTPLEIEFSHLYNGTTNQTCILWDENDGYIRSERSVILINFCLSIISS
NALILIGQTQTRNKVICTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFL
CLGWGLPALVVAISVGFTKAKGYGTVNYQMAVPLYGMTLKCSKCGVVSSAEVSATATSNA
MASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQ
DAVKCRVVDRQEEGNGDSGGSFQNGHAQLMTDFEKDVDMACRSGEHITVLNKDITTCRTS
TITGTLKRPSLPDEEKLKLNHQKGSSNFNSLPANVSKMHLQGSPHYLGAINLNEFSNHSL
TLKKDKNQPPKSIYICDGDIFKKLDSELSRAQEQTLDTSYVILPTNTSTLRAKPKDESKY
SINIDQMPQTRLIHLSMATDPGFVVKSPPREPVTMACSEAQGSSMIQQQQQLAPQNISNE
SQIPNSLCDTGDSGNSGVVSKSETVSTLSMSSLERRKSRYAELDFEKIMHTRKRHQDMFQ
DLNRKLQHAEKEKESPTTDSKQEKQQTPNKRPWEGIRKVQSPPSWVKKDIEPVAQSPLEL
KTVEWEKTGATIPLVGQDIIDLQTEV
NT seq 4401 nt   +upstreamnt  +downstreamnt
atgggaacagcccaaaccaaacctggagatggggtgtccctggggatagggacaccccaa
accaagcctggggacctggggatggggacagaccaatgcaccactttggtccaagggaaa
ttctttgggtatttctcttccttcgccgtcttcccgttgaactcctccctgtgctcttgg
attatccagaaccccgaccctcgcaggtacactttgtacatgaagatcctcaagccctcc
ggcgtatgtgaccaccagcacatccgcacctaccagttcgactccttcctggagtccacc
cgcacctacctgggcatggagagcttcgatgatgtgctgaagctctgtgatggctccacc
cgctttgccttcctccagtccaacaaacaattcctgcagatgaagcagacggccccgccg
ggtgtggacacctggcccatgaggtggaagcccaccaaggctcaggagagggacttctcc
gtggagtatctggtggtgggcaacaggaaccccagcaaagccgcctgccagatgctctgc
aagtggctggacgcctgcctggccatcagcagcagctcccacccgtgtggcatcatgcag
accccgtgctcctgctcgggaggggaggtcctggatcaggccagcgagatcctggggttc
accaggaagaaggaggattgctacaaggatgggatttacctggagaactgcgtgagcagc
cccaaggacagcaacggagcagaagggggttctggtggttggaactcctggtcggcttgg
ggcgactgcaccaaggactgcgggggcggcctgcagacccgcatgcgctcctgcaagccg
cttcccaacgagggcctggcctgcgagggagtgctggaggaaggacggctgtgcaatagg
aaggcttgcaataccaatggacgctataattccagaagccaatcgctgaggtccacagat
aacagaaagcgagaggaccctgacgaactgcagcactacgggtaccctgcacctcaaata
ggtgaccctgcagcagaggagtggtccccgtggagcgtgtgctcaaccacctgcggggag
ggctggcagaccaggaccaggttctgcgtttcgtcttcctacagcacccagtgcagcggc
cctctccgggagcagagacagtgcaacaactctgccgtgtgcccagtgcacggcacctgg
gacgagtggtctccatggagcctgtgctcttccacctgtgggagaggctacagggatcgg
acccgcacctgcaaacccccccagttcggtgggaacccctgcgagggcccagagaagcaa
accaagttctgcaacatcgctctctgcccaggtagggacatggacggcaactggaacgag
tggtcgagctggagctcgtgctccgcttcctgctccaacgggacccagcagcggacgcgg
gagtgcaacgggccctcctacggcggagccgagtgccagggacactgggtggagacccgc
gactgcttcctgcgccagtgcccagtggatgggaagggacaggcctggggagtgtggggc
agctgcactgccacatgtggaggtggcactcagagacgtgaccgggtgtgctacggcccc
ttcttcggtggggagacttgccagggtcccaaggaggagtacaagcagtgcaatgacaga
aaatgtcctgagccccatgaaatctgtgatgaggagagtcttggccccgtggtttggaag
gagacgccagccggggacgctgccgccgtccggtgtccccgcaatgccactgggctgatc
cttcgaagatgcatcttagatgaggaaggcattgcttactgggagcctccaacatacatc
aagtgtgtttctattgattacaggaacatacagatgatgaccagggagcaccttgccaaa
gctcagcgtgggttgatgggagatgggctgtcagatgtgctccagaaccttgtggaaatc
tcccaggatgggaccagctacagtggggacctgctgtccaccatggatgtactcaggaac
atgacagagatcttccgtagggcttatcacagcccgacttctggggatgtgcagaacttc
gtccagatcctcagcaacattttgtcagaggaaaaccgggaaaaatgggaggaagctcag
ctgatagggccaaatgccaaggagctgttcaggctcgtggaggatttcattgatgtcatc
ggcttccgcatgaaagatttccgggattcctaccaagtcacggacaatctggtccttggt
attcacaaactgcctgcaaacgcagcaactgacatcaccttccccatgaaaggctggagg
ggaatggtggactgggccaagaactcagaggacaaggtcactgtctccaagagcatcctg
tcttcagggctctcagtgtcagacgactcctctgtcttcgtggttgggaccgtgctctac
cggaacgtgggcaacatcctctccctgcagaggaacagcactgttctgaactccaaagtc
atctctgtgactgtgaagccattccctcggtctctcctcacccctctggaaatcgaattc
tcccacctgtacaatggaaccaccaaccagacctgcatcctgtgggatgaaaatgatggg
tacatccgctcggagcgctctgtcatcctcatcaacttctgcctctccatcatctcctcc
aacgccctcatcctcatcggacagacccagacccggaataaggtgatctgcacgctggtg
gcggctttcttgcacttcttcttcctctcctctttctgctgggtgctgaccgaggcctgg
cagtcctacatggccgtgacgggccggttacggaaccgcatcatccgcaagcgcttcttg
tgtctcggatgggggctccctgccttggtggttgccatttccgtgggatttactaaagcc
aagggatacggcaccgtgaactatcagatggcagtgcccctttacggcatgacgctcaaa
tgttccaagtgtggagtagtttcttctgctgaagtttcggccacagccaccagtaacgcc
atggcatccctctggagctcctgcgtggtgctgcccctgctggctctcacctggatgtcc
gcagtcttggccatcaccgaccggcgctcggcgcttttccagatccttttcgccgtcttc
gactccttggagggatttgtcatcgtcatggtccactgcatcctcaggcgggaggtccag
gatgctgtgaagtgccgggttgtggatcgtcaggaggaagggaatggagactcagggggg
tcgtttcagaacggacacgctcagctcatgaccgattttgagaaggacgtggacatggct
tgtagatcaggtgagcacatcacagtgctgaacaaagacatcaccacatgcagaacctca
accatcacggggaccctgaagcgcccgtcgctgcccgatgaggagaaactgaaactcaac
caccagaaaggctcatccaacttcaacagtcttccagccaacgtctccaagatgcacctt
cagggctccccacactacctgggggccatcaacctgaacgagttcagcaaccactcccta
accctgaagaaggacaagaaccagccgccgaaatccatctacatctgcgacggggacatc
ttcaagaagttggactcggagctctcgcgggcgcaggagcagaccctggacaccagctac
gtgatcctgcccaccaacacgtccaccttgagggccaaacccaaggatgagagcaaatac
agcatcaacatcgaccagatgcctcagacacggctcatccacctcagcatggccaccgac
cccggcttcgtggtcaagagtcccccgcgggagccggtgaccatggcgtgcagtgaggcg
cagggttcctccatgatccagcagcagcagcagctggctccacagaacatctccaacgag
tcacagattcccaacagcctgtgtgacacaggtgactcagggaactcaggtgtggtgtcc
aagagcgagaccgtctccaccctctccatgagctccttggagaggcggaaatcccggtat
gcagagttagattttgagaaaatcatgcacacaaggaaacgtcaccaagacatgttccag
gacctgaacagaaaactccagcacgcagagaaggagaaggagtctccaacaacggacagc
aagcaagaaaaacagcagacaccaaacaagagaccctgggaaggcatcaggaaagtccag
tccccgccatcatgggttaaaaaggacatcgaacctgtggcacagtctcccctagaacta
aaaactgtagagtgggagaaaacaggggccaccatccccttggtgggacaagacattatt
gaccttcagacagaggtctga

DBGET integrated database retrieval system