KEGG   Geospiza fortis (medium ground-finch): 102033219Help
Entry
102033219         CDS       T03755                                 

Gene name
NSD2, WHSC1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gfr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102033219 (NSD2)
Enzymes [BR:gfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102033219 (NSD2)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102033219 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box HMG_box_2 zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 102033219
NCBI-ProteinID: XP_005424766
LinkDB All DBs
Position
Un
AA seq 1367 aa AA seqDB search
MDFSIKRSSQLLTQKINCIKMKQVPEILGNTNGKPQNCEVNRECSVYLGKAQLSATLQEG
VMQKYNGHETLPFIPADKLKDLTSRVFNGESGAQDAKLRFEPQEIKGVGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDNGADVSQSEENEQKPANKERRSRKRSIKYDSLLE
QGLVETALVSKTSSTTEKKAPAKRDQTQSTIKEEKVHLLKYNIGDLVWSKVSGFPWWPCM
VSADPVLHAYTKLKGQKKSFRQYHVQFFGDAPERAWIFEKSLVPFKEKDQFEQLCQESAR
QALTKAEKIKMLKPVSGKLRPQWEMGVQQASEAVAMTVEERKAKYTFIYVRDRPHLNPRV
AKEVGIAVEPLEEMDESSYSHEETTPNLKSMKESGIPSKRRRRTSKLSAADDMQESSQLE
DKNTTPQKSSEQAESKRGIGSPLNRKKTPASTPRSRKGDAMSQFLVFCQKYRDEVVAEHP
DASSEEIEELLESQWNMLSEKQKARYNTKFAIVTSPKSEEDSGNLHGNKRNQKKRTKEPT
EDFEVQEAPRKRLRMDKQNNRKRETSNDKTAKTNSSKVTETSSSQKNQSATKNLSDACKP
LKKRNRASAAESSTLAFSKSSSPSASLTENEISDGQGDERSESPYESADETQTEVSISSK
KSERGVGTKKEYVCQLCEKTGDLLLCEGLCYRAFHVSCLGLSGRPTGKFICSECTSGVHT
CFVCKERKADVKRCVVSHCGKFYHEACVKKFHLTVFENRGFRCPLHSCLSCHVSNPSHPR
ISKGKMMRCVRCPVAYHAGDVCIAAGCTVIASNSIVCTNHFTAMKGKSHHAHVNVSWCFV
CSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCNDCRAGKKLHFQDIIWVKLGNYRWWPA
EVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGIKGIGK
VFKNALQEAETRFREIKLQREAKETQESERKPPPYKHIKVNKPCGKVQIYTADISEIPKC
NCKPTDENPCGFDSECLNRMLMYECHPQVCPAGERCQNQCFTKRQYPETKIIKTDGKGWG
LVAKRDIKKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNY
SRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCKCGAP
NCSGFLGDRPKNSSTNASEEKGKKTKKRTRRRRTKNEGKKESEDDCFRCGDGGQLVLCDR
KSCTKAYHLSCLGLVKRPFGKWECPWHHCDVCGKPSVSFCHFCPNSFCKEHQDRTVLNST
LNGQLCCSEHVLGVDSVETQKTEKPRKKLNKFKPRRKRNRWMRAECK
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
atggactttagcatcaaaagaagttctcaactgttaactcaaaaaattaactgcatcaaa
atgaagcaggtaccagaaatccttggaaataccaatgggaaacctcagaattgtgaagtg
aatcgtgaatgttctgtgtacttgggcaaagcacaactttctgccaccttacaggaaggt
gtcatgcaaaaatataatggccatgagactcttccatttattccagctgataaattgaaa
gatctgacctctcgggtgtttaatggcgagtccggggcccaggatgccaagctgcgcttt
gaacctcaggaaataaagggagttggaacaccccccaacactactcctatcaagaatggc
tctccagaaataaagctgaaaatcactaaaacctacatgaatgggaagcctcttttcgag
tcctccatttgtggagacaatggtgcagatgtgtctcagtcagaggaaaatgaacaaaag
ccagcaaacaaggagaggagaagcagaaaaagaagcataaaatatgactccttacttgag
cagggtcttgttgaaacagcattagtatcaaagacttcaagcaccactgaaaagaaggct
cctgctaagagagatcaaactcaaagtaccatcaaagaggaaaaagtccatctgttgaag
tataatataggagatctagtgtggtccaaagtgtctggtttcccatggtggccgtgtatg
gtttctgctgatcctgttctccatgcctacactaaactaaaaggacagaagaagagtttt
cgtcaatatcacgttcagttttttggagatgccccagagcgagcctggatatttgagaag
agcctggtgcccttcaaagaaaaagaccagtttgaacaattatgccaagagagtgcaaga
caagccctcactaaagcagagaaaataaagatgctgaagccggtgtcggggaagctgcgg
ccgcagtgggagatgggtgtgcagcaggccagcgaagctgtggcaatgacagtggaggag
cgcaaggccaagtacaccttcatctatgtcagggacagaccccacctcaaccctcgagtg
gcaaaggaggttggcattgctgtggaacccttggaggagatggatgagtcgtcctactca
catgaagaaaccactccaaatctgaaatcaatgaaggagtctggcattcctagcaagagg
aggagaaggacatcaaaactctctgctgctgatgatatgcaagagagcagtcagttggag
gataagaatactactcctcaaaagtcatctgaacaggcagaatccaaaagagggataggc
tcccctctcaatagaaagaaaactccagcatctactcctcgaagcagaaagggcgatgca
atgtctcagtttttggtcttttgtcagaagtacagagatgaggtggttgctgaacatcca
gatgcttcaagtgaggagattgaagagctgctcgaatcgcagtggaacatgcttagtgaa
aaacagaaagctcgctataacacaaagtttgccatagtgacctctcccaaatctgaagaa
gactctggtaatttacatggaaataaaagaaaccaaaaaaagaggacaaaggagcctaca
gaagattttgaagttcaggaagcacctaggaaaagactcaggatggataaacagaataat
cggaagagggagacaagcaatgacaaaacagcaaaaacaaactcttctaaggtcacagaa
acctcctcttcacaaaagaaccagtcagcaacgaaaaatctgtctgatgcatgtaaacct
ctgaagaagcgaaatcgggcttcagcagcagaatcttcaactcttgcttttagcaagagt
tcatctccttcagcttccttaactgagaatgagatctctgatggccaaggagatgagcgc
tcagagtccccctatgagagtgctgatgagactcagactgaagtgtctatatcatccaaa
aaatctgagcgaggagtgggaacaaaaaaagaatatgtgtgtcagctgtgtgaaaaaaca
ggtgatctcctgctgtgtgaaggactttgctatcgagcttttcatgtgagctgccttggg
ctctctggaagaccaacaggaaaattcatttgtagtgaatgtacatcaggtgtgcacacc
tgtttcgtgtgtaaggagagaaaggcagatgtgaaacgctgtgttgtgtctcactgtggc
aaattctaccacgaagcttgtgtgaaaaaatttcatctcactgtcttcgagaacaggggg
tttcggtgtcctctccacagctgcctcagttgtcatgttagtaacccctcacatccacga
atttcaaaagggaagatgatgcgctgcgtgcgctgcccagtcgcgtaccacgccggggac
gtttgcatcgcggcgggatgcaccgtcatcgcctccaacagcatcgtctgcaccaaccac
ttcactgccatgaaggggaaaagccaccacgcccatgtcaatgtcagctggtgctttgtg
tgctccaaaggtggcagtttactgtgctgtgagtcctgcccagcagcctttcaccctgac
tgcttaaacatcgaaatgccagatgggagctggtactgcaatgactgcagggcgggcaag
aagctccatttccaggatattatttgggttaaactgggaaattacagatggtggcctgca
gaagtttgccatccgaaaaacgttcccccaaatatccagaaaatgaagcatgaaatcgga
gaatttcctgtgtttttctttggttctaaggattactattggacgcaccaagcacgggtg
ttcccttacatggagggagacagagggagtagataccaagggatcaaaggaattggaaaa
gtcttcaaaaatgctttgcaagaagctgaaactcgatttcgagaaataaaactacagcga
gaagccaaagaaacccaggagagtgaacgtaaacctccaccatacaaacatattaaggtg
aacaaaccttgtggcaaagtgcagatctacactgctgacatatctgagattcccaagtgc
aactgcaaacccacggacgagaacccgtgtggctttgactcggagtgcctgaaccggatg
ctgatgtacgagtgccacccccaggtgtgcccggcgggggagcgctgccagaaccagtgc
ttcaccaagcgccagtaccccgagacaaagatcatcaaaactgatggcaaaggctggggg
ctggtagccaagagggacatcaaaaagggggagtttgtcaatgagtatgtgggagagctg
attgatgaagaggagtgtatggcaagaatcaaatatgcacatgaaaatgacatcacccac
ttctatatgcttactattgataaggaccgaattattgatgctggccccaaaggaaactat
tcccggttcatgaaccacagctgccaaccaaattgtgagaccctgaagtggacagtgaat
ggagacactcgtgtggggctctttgctgtgtgtgacattcctgcagggacggagctgact
tttaattacaaccttgactgtctgggcaatgaaaaaacagtctgcaaatgtggtgcccca
aactgcagtggatttcttggggacagaccaaagaattcttccactaatgcctcagaagaa
aaaggcaaaaagaccaaaaagagaacacggagacgcagaacgaaaaatgaagggaagaaa
gaatctgaagatgattgttttcgttgtggtgatggaggccagctggtgttgtgtgacagg
aaatcttgtactaaagcttatcacctctcctgccttggtttggtgaaacgtccttttggg
aagtgggagtgtccttggcaccactgtgatgtttgtggcaaaccttctgtttctttctgc
cacttctgtccaaactctttctgcaaggagcaccaagacaggacagtgctaaattccacc
ttgaatggacagttatgctgctctgaacacgttctcggggtggattctgtggaaactcag
aagactgagaaaccccgcaaaaaactgaacaagttcaagcccaggagaaagaggaataga
tggatgagagctgaatgcaaatag

DBGET integrated database retrieval system