KEGG   Geospiza fortis (medium ground-finch): 102033491
Entry
102033491         CDS       T03755                                 

Gene name
RRM2
Definition
(RefSeq) ribonucleotide reductase regulatory subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00230  Purine metabolism
gfr00240  Pyrimidine metabolism
gfr00480  Glutathione metabolism
gfr00983  Drug metabolism - other enzymes
gfr01100  Metabolic pathways
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102033491 (RRM2)
   00240 Pyrimidine metabolism
    102033491 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102033491 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102033491 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102033491 (RRM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gfr03400]
    102033491 (RRM2)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     102033491 (RRM2)
DNA repair and recombination proteins [BR:gfr03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    102033491 (RRM2)
SSDB
Motif
Pfam: Ribonuc_red_sm Gag_spuma
Other DBs
NCBI-GeneID: 102033491
NCBI-ProteinID: XP_005420350
LinkDB
Position
Un
AA seq 424 aa
MASIGTVFALHRRLKTGDQQRENAKRAAKGKRKECLEPVSQRRSKEWDLSPPAQPLSLGG
VLPSSQPLSLGGLPELPPSVSLRSPAPPRAALPPFQVPRAVEEEEPLLRENPRRFVIFPI
QYHDIWQMYKKAEASFWTAEEVDLSKDVQHWESLKPEEKYFISHVLAFFAASDGIVNENL
VEQFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETLPCVKK
KADWAMCWIGDKKATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRD
EGLHCDFACLMFKHLIHKPSEERVREIIMNAVLIEQEFLTEALPVKLIGMNCTLMKQYIE
FVADRLMLELGFNKIYKAENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSKPTDNSFTL
DAEF
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcctctatcgggaccgtgtttgccttgcatcggagactgaaaacaggagaccagcaa
agagaaaacgcaaagagagcagcaaagggaaaacgcaaagagtgcctggagcctgtctcg
cagcgaagatcaaaagaatgggatctctccccccccgcccagcccctctccctcggaggg
gtccttccgtcctcccagcccctctccctcgggggtctccccgagctgccgccctcagtg
tccctccgcagcccggccccgccccgagccgctctcccgccattccaggtgccgcgggcc
gtggaggaggaggagccgctgctgcgggagaacccccgccgcttcgtcatcttccccatc
cagtaccacgacatctggcagatgtacaagaaggccgaggcctctttctggacggcggag
gaggtggacctttctaaagacgtccagcactgggagtccctgaagcctgaggagaagtac
ttcatttctcatgtcctcgccttctttgctgccagtgatggcattgtcaacgagaacttg
gtggagcagttcagtcaagaagtgcaaatcacagaggctcgctgtttctatggcttccag
attgccatggaaaatatacattcagaaatgtacagtcttctcattgacacctacattaag
gactcaaaggagagggaatttcttttcaatgctattgaaacgttgccatgtgttaaaaag
aaggcagattgggccatgtgctggattggggacaagaaagcaacatatggagaacgtgta
gtggcctttgcagctgtggaaggaatcttcttttctggctcttttgcatcaattttttgg
ctgaagaaaagaggattaatgcctggactcactttttctaatgaactcatcagtagagat
gagggtttgcactgtgattttgcctgcctcatgttcaagcacttgatacacaaaccatca
gaggagagagtaagggaaatcatcatgaatgctgttctcatagaacaggaattcttgacg
gaggcactgcctgtgaagctgattggcatgaactgcactttaatgaaacagtacatcgag
tttgtggcagaccggcttatgctggaactgggatttaacaagatatacaaagcagagaat
ccttttgacttcatggaaaacatctctctggaaggcaagaccaatttctttgagaagcga
gtaggtgaatatcagaggatgggagtcatgtccaagcccacagacaactctttcaccctg
gatgcagagttctga

KEGG   Geospiza fortis (medium ground-finch): 102036141
Entry
102036141         CDS       T03755                                 

Gene name
RRM2B
Definition
(RefSeq) ribonucleotide reductase regulatory TP53 inducible subunit M2B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00230  Purine metabolism
gfr00240  Pyrimidine metabolism
gfr00480  Glutathione metabolism
gfr00983  Drug metabolism - other enzymes
gfr01100  Metabolic pathways
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102036141 (RRM2B)
   00240 Pyrimidine metabolism
    102036141 (RRM2B)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102036141 (RRM2B)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102036141 (RRM2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102036141 (RRM2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gfr03400]
    102036141 (RRM2B)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     102036141 (RRM2B)
DNA repair and recombination proteins [BR:gfr03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    102036141 (RRM2B)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 102036141
NCBI-ProteinID: XP_005423518
LinkDB
Position
Un
AA seq 297 aa
MYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHVLAFFAASDGIVNENLVARFSQE
VQIPEARCFYGFQILIENVHSEMYSLLIDTYIKDPKKRDFLFNAIETMPCVKKKADWALK
WIEDRESTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDF
ACLMFHYLVNRPSEERVCEIIVNAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLL
MELGFSKVFNAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETMDNVFTLDADF
NT seq 894 nt   +upstreamnt  +downstreamnt
atgtataagcaggctcaggcctccttttggacagcagaagaggttgatttgtcaaaggac
ctgcctcactggaacaagctgaaagcagatgaaaaatactttatctctcatgttctggca
ttttttgcagccagtgatggaattgtaaatgaaaacctggtggcacgttttagtcaggag
gtgcagatcccagaagctcgttgtttctatggctttcagattctcattgagaacgttcac
tcagagatgtacagcttgctcatagacacctacatcaaagatcccaagaaaagggatttc
ttgtttaatgctattgaaacaatgccttgtgttaagaagaaagcagactgggctctgaag
tggattgaagaccgagaatccacttttggtgagagagtggttgcctttgctgcagtggaa
ggcatcttcttttcgggttcctttgctgctatattttggctgaagaagaggggcctgatg
cctggattgactttctccaatgaacttattagcagagatgagggtctgcactgtgatttt
gcttgtctaatgttccattatttagtgaacagaccatcagaagagcgagtgtgtgagatc
atcgttaatgctgtagagattgagcaggagtttctaactgaggcattacctgtgggtctg
attggaatgaattgcaccttgatgaaacagtacatcgaatttgttgccgaccggttactg
atggagcttgggttctcaaaggtctttaatgcagaaaatccttttgatttcatggagaac
atttctctggaaggaaaaacaaatttctttgagaagcgggtttcagaatatcaacgtttt
gctgttatggcagaaacaatggacaatgtcttcactctagatgcagatttttga

DBGET integrated database retrieval system