KEGG   Geospiza fortis (medium ground-finch): 102033495
Entry
102033495         CDS       T03755                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
gfr05132  Salmonella infection
gfr05164  Influenza A
gfr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102033495
   04115 p53 signaling pathway
    102033495
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102033495
  09172 Infectious disease: viral
   05164 Influenza A
    102033495
   05168 Herpes simplex virus 1 infection
    102033495
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 102033495
NCBI-ProteinID: XP_005421805
UniProt: A0A6I9HHI3
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFVQKCSQCHTVEKGGKHKTGPNLNGLFGRKTGQAEGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKVATAK
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagacgtcgagaaaggcaagaagatctttgtccagaaatgctcccagtgccacacg
gttgaaaagggaggcaagcacaagactggacccaacttgaacggcctgttcggacgcaag
actgggcaagctgaaggtttctcttacacggatgctaataagaacaaaggtatcacctgg
ggtgaggatactctgatggagtatttggaaaatccaaagaagtatatccctggaacaaag
atgatttttgcgggtattaagaagaagggcgagagagcagacttaatagcatacctcaaa
gttgccactgcaaagtaa

DBGET integrated database retrieval system