KEGG   Geospiza fortis (medium ground-finch): 102033692
Entry
102033692         CDS       T03755                                 

Gene name
CCND3
Definition
(RefSeq) cyclin D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
gfr04310  Wnt signaling pathway
gfr04510  Focal adhesion
gfr05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102033692 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102033692 (CCND3)
   04115 p53 signaling pathway
    102033692 (CCND3)
   04218 Cellular senescence
    102033692 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102033692 (CCND3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102033692 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102033692
NCBI-ProteinID: XP_005428948
UniProt: A0A6I9HTQ8
LinkDB
Position
Un
AA seq 235 aa
MRKMLAFWMLEVCEEQKCEEEVFPLAMNYVDRFLASVAVQKNHLQLLGAVCMLLASKLRE
TMPLTVEKLCIYTDNSITPEELLRWELLVLEKLKWDLVSVIANDFLPHILQLLPLXXXXV
ELVKKHAQTFIALCATGGGSWHTWHGSPPVLGASWQSRFKVGWCSWGGEALTELLARTTG
TELDCLKACQEQIEAALAESLKQASQSQPEFSSKAVPYAGSQPTSTPTDVTDVNL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgcggaagatgttggccttctggatgctggaggtgtgtgaggagcagaagtgtgaggag
gaggtgttccctctggccatgaactacgtggatcgcttcctggcctcggtggccgtgcag
aagaaccacctgcagctgctgggggctgtgtgcatgctgctggcctccaagctcagggaa
accatgcccctgaccgtggagaagctctgcatctacaccgacaactccatcacccccgag
gagctgctgcgctgggagctgctggtgctggagaagctcaagtgggacctggtgtcggtg
attgccaacgatttcctgccccacatcctgcagctgctgccgctnnnnnnnnnnnnggtg
gagctggtgaagaagcacgcgcagaccttcatcgccctctgtgccacaggtgggggctcc
tggcacacctggcatgggtccccgcctgttttgggggcttcttggcagtcaaggttcaag
gtggggtggtgctcctggggcggagaggccctcaccgagctgctggccaggaccacgggc
accgagctggactgcctgaaggcctgtcaggagcagatcgaggctgccttagccgagagc
ctgaagcaggcatcccaatcccagccggaattcagctccaaggcggtgccctacgcgggc
agccagcccaccagcacccccacggacgtcaccgacgtcaacctgtga

KEGG   Geospiza fortis (medium ground-finch): 102034688
Entry
102034688         CDS       T03755                                 

Gene name
CCND2
Definition
(RefSeq) cyclin D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
gfr04310  Wnt signaling pathway
gfr04340  Hedgehog signaling pathway
gfr04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102034688 (CCND2)
   04340 Hedgehog signaling pathway
    102034688 (CCND2)
   04068 FoxO signaling pathway
    102034688 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102034688 (CCND2)
   04115 p53 signaling pathway
    102034688 (CCND2)
   04218 Cellular senescence
    102034688 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102034688 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 102034688
NCBI-ProteinID: XP_005426462
UniProt: A0A6I9HNR5
LinkDB
Position
Un
AA seq 285 aa
MELLCCEVDPMRRALPDPNLLYDDRVLHNLLTIEERYLPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQQLLEWELVVLGKLKWNLATVTPHDFIEHILRKVPLPKDKLLLIRKH
AQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDDGDSLTDLLAKITNTDVDCLKAC
QEQIEAVLVNSLQQVQQQQQQSSPSKTVDELDQASTPTDVRDINL
NT seq 858 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggatcccatgaggagagctctgcctgacccgaacttg
ctctacgatgaccgcgttttgcacaacttactaaccatagaggaaaggtatctgccccaa
tgctcctacttcaagtgcgtccagaaggacatccagcccttcatgaggaggatggtggcc
acttggatgctggaggtctgcgaagagcagaagtgcgaagaagaagttttccctctggcc
atgaattacttggacagattcttagctgtggtgcccactcggaagtgccatctgcagctg
ctgggggcggtgtgcatgttcctggcctccaagctgaaagagacaatccccctcacagcc
gagaagctgtgcatatacacggacaattccatcaaaccccagcagctgctggaatgggag
ctggtggtgctggggaagttgaagtggaaccttgcaaccgtcaccccacacgatttcatt
gaacacattctaaggaaggtgcctctccctaaagacaagttgcttttgatccggaagcat
gcacaaaccttcatcgccctttgtgccacagattttaactttgccatgtacccaccatca
atgatagcaactggaagtgtgggagcagccatctgtggccttcagctcgatgatggggac
agcctcacggacctcctggccaagatcacaaacacagatgtggactgccttaaagcttgt
caggaacagatcgaggcggtgctcgtgaacagcctgcagcaagtccagcagcagcagcag
cagagcagcccctccaagacagtggatgaactggaccaggccagcactcccacagatgtg
agagacatcaacctgtga

KEGG   Geospiza fortis (medium ground-finch): 102042858
Entry
102042858         CDS       T03755                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
gfr04310  Wnt signaling pathway
gfr04340  Hedgehog signaling pathway
gfr04371  Apelin signaling pathway
gfr04510  Focal adhesion
gfr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102042858 (CCND1)
   04340 Hedgehog signaling pathway
    102042858 (CCND1)
   04371 Apelin signaling pathway
    102042858 (CCND1)
   04068 FoxO signaling pathway
    102042858 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102042858 (CCND1)
   04115 p53 signaling pathway
    102042858 (CCND1)
   04218 Cellular senescence
    102042858 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102042858 (CCND1)
   04530 Tight junction
    102042858 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102042858
NCBI-ProteinID: XP_005426170
UniProt: A0A6I9HMV3
LinkDB
Position
Un
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctcaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgttcgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggccgcaatgaccccccacgatttc
attgaacatttcctcactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccaccc
tccatgatcgcagctggcagcgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgagtccctcctggagtccagtctacgc
caggcacagcagcacaacgtatcctcagaaacaaagactgtagaggacgaagcagacctc
tcctgcacacctactgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system