KEGG   Geospiza fortis (medium ground-finch): 102034008
Entry
102034008         CDS       T03755                                 

Gene name
GTSE1
Definition
(RefSeq) G2 and S-phase expressed 1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102034008 (GTSE1)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 102034008
NCBI-ProteinID: XP_005423594
UniProt: A0A6I9HJQ3
LinkDB
Position
Un
AA seq 671 aa
MEEKKEMSVDSLSHLTEEKLDICMSNVSDFPLLTDEKFDFDLSLSSTSGNEDEVFVGPVG
HKERCIAASIEAKKSVSAFDDKRMWSPLQGEKFVEIFKEAHLLALQIETGSKDEETKISQ
SEEQENKIVETFVEDSKSKLKILRNKNIAISPRPVKRETYCVQDSPACQLPPCFQKPSQK
LVSDGKVHALPAPPNRSPVKISVSPTKNASLPLTEERETKETNTKAIGKLPVAKPSSASG
KSNLLTIDKPGLRKMTYLKCPRVASGLTRKTASSSSSSSVSSMNSSLNSSLPISPIGKKG
KSSMPSKASVSKLSTSTGRLALVRPATVSSLQAANTEKFRKQVRSASTPKIPSAMSLPKS
SASTASSEAAGSGIRRPSSVSSLQQLCQQNKDGTSAKGSLCPKPKARILSASTSQTKAPV
KTQDATPNKLAPKATPSLGLTFCGTPGSAMAVSTPMKGSEDKAFQGFCFPERFATMTPAS
VKRSGLPTPVRRISGFPAVTPKTIPRMPTSPHAASLRQSFSFSTKKTFTAGSRQKQESKT
QTSSEDDTSPPAVLPLVLNFSPEKTATEGAENALKEAEVHNELAKTQNELAEEKQPEALL
LDIGADKSLPHTSECESRPLIDLSNTPEVSKITSAKPVLSGQIKLIDLSSPLITLSPDVN
KENLDSPLLKF
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggaggaaaaaaaagaaatgtcagtagatagcctgagtcatttgactgaagaaaagctg
gatatttgcatgagcaatgtttcagactttcctcttctgactgatgaaaagtttgatttt
gacctttcactctcttcaacaagtggaaatgaagatgaagtttttgttggacctgtggga
cacaaagaaagatgtattgctgccagtattgaagcaaaaaagagtgtgtctgcttttgat
gataaacgcatgtggagcccacttcaaggagagaaatttgtggaaattttcaaagaagct
catttgttggcactgcaaatagagactggaagcaaggacgaggagaccaaaataagccaa
tcagaagaacaggaaaacaagattgtagaaacatttgtggaggactcaaagtcaaagctg
aagatactgagaaacaaaaacatagcaataagtcccaggcccgttaaacgggagacatac
tgtgtgcaggatagcccagcatgtcagctgccaccttgttttcagaagccatcacagaaa
cttgtgtcagatggcaaagtgcatgctcttcctgctcctcctaacagaagccctgttaaa
attagcgtgtctcctacaaaaaatgccagtttacccctaacagaggagcgggaaactaag
gaaacaaatacaaaggcaattggcaaactaccagtggcaaaaccttcatctgcttctgga
aaaagcaatttgttgacaattgacaagcctggcttaaggaagatgacatatctgaaatgt
cctcgtgttgccagtggtctcacaaggaagactgcgtcatcatcatcttcatcatcagtt
tccagcatgaactcaagtcttaattcaagtttaccaatttctcctataggcaaaaaagga
aaatcaagcatgccatcaaaagctagtgtgagtaagctttcaactagtacaggcaggctg
gcccttgtcagacctgctacagtgtcatctctgcaggctgccaatactgagaaattcagg
aagcaagtgagatcagctagcactcccaaaatacctagtgccatgagcctgcctaaatct
tcagcttctacagcatcatctgaggctgcaggcagtggaattcggagaccaagctctgtt
tccagtctgcagcagctctgtcagcagaataaagatgggacttcagcaaaaggaagcctg
tgtccaaagcccaaggctagaattttgtctgcttccacaagtcaaactaaggctcctgtg
aagactcaagatgcaacaccaaacaagttggcaccaaaagcaacaccgtctcttggatta
acattttgtggcacacctggaagtgccatggcagtcagcactcctatgaaaggctcagaa
gataaggccttccagggtttttgttttcctgagaggtttgccaccatgactccggccagt
gtgaagcggtctggcctgcctacacctgtccgtcggatctcagggttcccagcagtgact
cccaaaactataccaagaatgccaacttctccacatgctgcatctcttcggcagagcttc
agcttttctaccaaaaagacttttacagctggttctagacagaaacaagagagtaaaaca
cagacatcttcagaggatgatacgtctcctccagctgtgctacctcttgtacttaacttc
tcgccagagaaaactgctacggaaggagcagaaaatgcattaaaagaggcagaagtacac
aacgagctggctaaaacacaaaatgagctggcagaagagaaacaacctgaggctttactg
ctagatattggagcagacaaatcactcccacacacttctgaatgtgaaagcagacctttg
attgacctttccaatactcctgaagtgagtaagattacttctgcaaagcctgtgttatct
gggcagataaagctaattgatttgagttctcctcttatcactctgagccctgatgtaaac
aaagaaaatctggattcccctctactgaagttctga

DBGET integrated database retrieval system