KEGG   Geospiza fortis (medium ground-finch): 102034037Help
Entry
102034037         CDS       T03755                                 

Gene name
KMT2D
Definition
(RefSeq) lysine methyltransferase 2D
  KO
K09187  histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102034037 (KMT2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gfr03000]
    102034037 (KMT2D)
   03036 Chromosome and associated proteins [BR:gfr03036]
    102034037 (KMT2D)
Enzymes [BR:gfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102034037 (KMT2D)
Transcription factors [BR:gfr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    102034037 (KMT2D)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102034037 (KMT2D)
   HMT complexes
    MLL-HCF complex
     102034037 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC FYRN SET zf-HC5HC2H_2 zf-HC5HC2H PHD_2
Motif
Other DBs
NCBI-GeneID: 102034037
NCBI-ProteinID: XP_014166367
LinkDB All DBs
Position
Un
AA seq 3840 aa AA seqDB search
MDEQKVPSEEKDAAAPADGVMASEEMGSAEGDPLKPPPGASAGPEPDSTGTEGPPEAARA
LLGAPLVCGLGGRCGAGGGRRGQSCFLRDLTEDTRCSVCNGPGELQDLVFCTSCGQHFHG
ACLDISLTPRKRSGWQCPQCKVCQTCRQPRQDSAMLVCEACDKGYHTSCTEPATQGLPTG
SWKCKNCWVCSDCGQHPDSSCQWSPGSEACGDCQQRRATADVPTADVPTAPEPSPQPDPP
AQMSESPVPSNSMDAPMPPPELEPVGCDEETQPLVDPKEAPPDPKEAAPDPKEAAPDPKE
APPGNAESPPGELASVEVPPSEEPPEELPSDELPLDQPPPDAQPSDIQPPEVQPPEEPPP
LTLPPEEPPCEELPLETPSLAELPPDSPPSEELPPSDPPHNEPPPPEEAPRLEREGTSGS
SPPLSEEDALEESRAGGDPEAKGSPSGSPLLLEPEELGPETPMEVCTTGEKLLGHGDEGC
PEPPALRPRPDILNEISNLSQGDTSSSFPGSEPLLGSPDPEGGGSLSPELGPASADASLQ
KEDAGSLPLGAETDDSLLFEPAAKGDGDKSRRRSSPGRSRVKQGRSSSFPGRRRPRGGSH
GGRGRGRARLKSTTSSVDTLALADVESSPSKEEDEDDDDTMQNTVVLFSNTDKFVLMQDM
CVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGKASDP
SRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVCCVQCGAASPGFHCEWQNNYTHCA
PCASLVVCPFCREKYVEDDLLIQCRHCDRWLHAACDSLFTEEEVEQAADEGFDCSACQPY
VVKPVPAPSAEMIKAKDPEPQYFRFEGVWLTETGMAVLRNLTLSPLHKRRQRKGRPGTLN
GDGGLEGGDPLGPEDKKDGDLDTDELLKADVGVEHMECEIKLEAPASPDRDVGADGDSGK
GLEDPEECKKRKRKPYRPGIGGFMVRQRKSHTRLKKVTAVLPDVGREGLSTEGHPEDAPG
DVPAEAGLDPGSGEGDEKKKRRGRKKSKLEDMFPPYLQVGWMEGLQLAGGMAPARPALGQ
GAPRPKGDPNLAGALQGGTPDRRETPTHPRGDDSTDGSAAAPDDDGKDDAKAEELGADEP
KDSPDRGDSEKPATPGEGALSSDLDKIPTEELPKMESKDVQQLFKDVLGSAERGEQPLNC
VAAGMEAGQDPSRAQRPFLQGDLPLGSLSGSVSLDSYSGVCQSPFLDNRERSGFFSPDHC
EPESPWASSSAATTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGELSTISPVLYANM
NFPNLKQDYPDWWSRCKEIMQLWRKPPMRFTFPPAVSEPLKGSPSHQPHGINSHYGSGKP
QSSAYASSPSFHQPPAPPQQQDPSGAFLPRTALGLTADKREEVAAGLSAPPNRDLAELPG
AQDGALGTMSQSELEKQRQRQRLRELLIRQQIQRNSLREPACGCLLLTSGLAAGTPMGSL
GARLPTPAEAVPPSPAALGAPFIELRHNVQKGPGGVVGSPFAPQAPRPRFFLPGEEGTPQ
ALCTPVMPLQALPTQKVPAPLPPASPQGAEMGNSHQQPHAKVAPPLPAPTLELQQHIPPR
PLSSGATLRPEGAKDGPAPDPAPAPGKSHLSLEGGRLPCEVPVEPDLDDDFGSHKDLEDD
DDLANLSLDPDVAKGDDDLDNLDSLETADPHLDDLLNGDEFDLLAYTDPELDTGDKKDIF
NEHLRLVESANEKAEREAQLKTEPPAPTLKLPDPGDSKDGAEAKAGSLPTDVKPKLEDGC
LKTSPCQFTTAGPPIKSEALQGTDKISASLGLSVKPGQTLLSSSTGPTRLGMTQFSNSGH
AGVPVLEKDPYTGPGRGLATAQLGGQSNPLLEKFELDSGALGLGSARHSPADDLDKMESS
LVASELPLLIEDLLEHEKKELQKKQQMSAHLPRGTPHLQAPGHPMLHTGASGQPPEGQPP
RLGTPQTPLQLGLVARPPLLPPQPPRLGAPQQGPALAPHMGMGSGQPHVLSSPHGVQVAL
GQPQQSQQQVLVQKPMAGVQPPSLGLKPPQLVMQQQLANSFFPDTDLDKFAAEDIMDPIA
KAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGPAVSEMQNHLLAGSGQERSG
TDPTQARPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGAHRKSRKALCA
KQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQHQH
QASAVMALSPSQSPRLMSKLPGQLLSAHGVQQPGGALGMQPTPAVLAAKDQPAGMDGSAL
HAEGGESGRELHGEQQGALNPPGLGEPQAPKHQAELGQGQQLLLSSPQPGVMRAAPGQPG
ALLAPTLQSPGAVHAELSQQHGDTAGGAEQPLGCGTGPAQAMVPAPRPPEQPGKGVAGAL
PGQPQPPRLQSPVQHKVGPASGTATLPPGLLGQVPGPVMGQIRAQLQGVLAKNPQLRHLT
PQQQQQLQALLVQRHQQSLLQQNQALRTPGPFPGQAPDYSLPATRQPPRPMGSLFQPRAD
APTEAQSSSATEAGRALPGQPPQQPPAELVQAALAARGPQPGLIRLPTPPAPSPLGCAPQ
HLASPEQSPQEPKKTSPGIPALAPSPAAPTEPGLTPTPSGALPDPAHGPWDPEAPGVDPA
DPAETRINGAVPEGAPAAGEAPQVLVKQEPKEEAAAVAQCEVDGDETAKPEANGDPGDNQ
ANSLLAPGGRSEAGHLLLQKLLRAKNVQLSAQSPGELNGHMENRSAGAEPRPQSLLLGRE
DPSIARKPAPTKPKRVQKGNERIPASRKKLRKDEGLRPGEALMKQLKQELSLLPLTEPTI
MANFSLFAPFGSSPINGKSQLRGTFGSAVLDSVPDYYSQLLTKNNLSNPPTPPSSLPPTP
PPSVQQKMVNGVTAPEELGEQPKDADPAREPHSQKAVEVKSLDLLAALPTPPHNQTEDVR
MESDDESDSPDSIVPASSPESVLGEELLRFPLLSEAKPELEERVLSPIIPIIPRASIPVF
PDTKPYEAAEPFGAPPGKVGAAGPGAPWEKGKSSEVSVMLTVSAAAAKNLNGVMVAMAEL
LSMKIPSSYEVLFPDGPVRAAVVEAKKVETDMAGMLGGKEKALAGKVPDSSSEWLKQFDA
VLPGYSLKGELDLLTLLRQESPAPEKTLHHCYVNNVSNLDVRQLSVLPQEPSPPLSPRSK
PRSRPLEDGDEARPRLKKWKGVRWKRLRFLVTIQKGGAKRDGDKEIAEFIDKLGTTLRPE
KVPQDMRKCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALINVEVA
LHRGLLTKCSLCQKTGATNSCNRIRCPSVYHFACAIRAKCMFFKDKTMLCPLHKLKGPCE
QELSSFTVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSVT
ALYPVGYEATRIYWSLRTNNRRCCYRCTICENNGRPEFVVQVIEQGLEDLVFTDSSPQAV
WNRIIEPVAMMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGR
HPLMELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHS
KSSQYRRLKTEWKNNVYLARSRIQGLGLYAAKDIEKHTMVIEYIGTIIRNEVANRREKIY
EEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIP
KGEEVRTRRNRDREWFREPGGTGNGAGVVPRTGRKQGKNRDREPSGTGTRNPTGLGTGRE
NT seq 11523 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacagaaggtgcccagcgaggagaaggacgcagccgcgccagctgatggggtc
atggcctcggaggagatgggcagcgccgagggggaccccctgaaaccccccccaggagcc
tctgcggggccagagccggacagcacgggcacggagggacctcccgaggctgccagggca
ctgctgggtgcaccactggtgtgcggcctgggcggccggtgcggggccggaggtggccgg
cgtggccagagctgttttctcagggatctcacagaggacacgcggtgctcggtgtgcaac
gggccgggcgagctgcaggacctggtgttctgcaccagctgcgggcagcacttccacggg
gcctgcctggacatctccctgacgcctcgcaagcgctcgggctggcagtgcccccagtgc
aaagtgtgccaaacctgcaggcagccccgtcaggactctgccatgctggtgtgtgaggcg
tgtgacaagggctaccacacctcctgcacggagccagccacccagggcctccccaccggc
tcctggaagtgcaagaactgctgggtctgctcagactgtggccagcaccccgactccagc
tgccagtggtccccagggtcggaggcgtgtggggactgccagcagcgccgtgccacggct
gatgtccccacggctgatgtccccacggcaccagaaccctccccacagcctgacccaccc
gcccagatgtcagagtcccctgtccccagcaactcgatggacgcgcccatgcccccgcct
gagctggagcctgtggggtgtgatgaggagacacagcccctcgtggaccccaaagaggca
cccccagaccccaaggaggcagccccagaccccaaggaggcagccccagaccccaaggag
gctcccccaggcaatgctgagtctcctcctggcgagctggcctctgtggaggtgcccccc
agtgaggaaccccccgaagaacttccctcagatgaactgcccctcgatcagccgcccccc
gacgcgcagccctctgacattcagcctcctgaagtgcagccccctgaggagccccctcct
ctcacgctgccccccgaggagcctccctgtgaggagctgccccttgagacaccatccctt
gctgagctgccccctgacagccctccctcggaggagctgccccccagtgacccaccccac
aacgagccgccaccccctgaagaagcaccaaggctggagagggagggcaccagtggaagc
tccccaccactcagtgaggaggatgccctggaagaaagccgggctgggggggaccctgaa
gccaaggggtccccttcgggttcccccctgctcctggaaccggaggagctgggccctgag
acccccatggaggtgtgcactaccggcgagaagctgctgggccacggggacgaggggtgc
cccgagccccccgcgctgcgcccacggcccgacatcctcaacgagatctccaacctgagc
cagggggacacaagcagcagcttccccggctcagagccactgctggggtccccagaccct
gagggtggggggtctctgtcccctgagctgggcccggcctcggctgatgccagcctgcag
aaggaggacgccggctcactgccgctgggtgctgagaccgatgactcgctgctcttcgag
ccagcagccaagggggacggcgacaagagccggcgccgcagctccccggggcgctcccgt
gtcaagcagggtcgcagcagcagcttcccagggcggagacgcccccgaggtggctcccac
gggggccggggccgaggccgtgcacgcctgaagtcgaccacctcgtctgttgacacctta
gcactcgctgacgtggagagctcgcccagcaaggaggaggatgaggacgatgatgacacc
atgcagaacacagtcgtcctcttctccaacactgacaagtttgtgctcatgcaggacatg
tgcgtggtgtgcggcagctttgggcgcggggccgaggggcacctgctcgcctgctcccag
tgctcccagtgctaccacccctactgtgtcaacagcaagatcaccaaggtgatgctgctg
aagggctggcgctgcgtggagtgcatcgtgtgcgaggtgtgcggcaaagcctcggacccc
tcgcgcctgctgctctgcgacgactgcgacatcagctaccacacctactgcctggacccc
ccgctgcagaccgtgcccaagggcggctggaagtgcaagtggtgtgtgtgctgtgtgcag
tgtggggctgcatcccctggcttccactgcgagtggcagaacaactacacccactgtgca
ccctgtgccagcctggtggtgtgccccttctgccgtgagaaatacgtggaggacgatctg
ctcatccagtgccggcactgcgatcggtggctgcatgctgcgtgtgacagcctcttcact
gaggaggaggtggagcaggctgcggatgaaggtttcgactgcagcgcctgccagccctac
gtggtcaaacccgtgcccgcgccttctgcagagatgatcaaagccaaggatccagagccc
cagtatttccgcttcgagggcgtgtggctgacggagacggggatggccgtgctgcgcaac
ctgaccctgtcacccctgcacaagcggcggcagcgcaagggccgcccgggcaccctcaac
ggggacggggggctggaggggggcgaccccctgggccctgaggacaagaaggacggtgac
ctggacaccgatgagctgctcaaagctgacgtgggtgtggagcacatggagtgtgagatc
aagctggaggctccagccagccctgaccgcgacgttggagccgatggggactcagggaag
gggctggaggaccctgaggagtgcaagaagaggaagcgcaaaccgtaccggcctggcatc
ggtgggttcatggtgcggcagcgcaagtcccacacgcggctcaagaaggtcacagcagtg
ctgccagacgtggggcgtgaggggctgagcaccgagggacaccctgaggatgctcctggt
gatgtcccagccgaggctggcctggatccaggctcaggagaaggggacgagaagaagaag
cgccggggacggaagaagagcaagttggaggacatgttccccccgtacctgcaggtggga
tggatggaggggctgcagctggctggggggatggcgcccgcccgccccgccttgggccag
ggtgccccaaggcccaaaggggaccccaacctcgctggggcactacaggggggcaccccg
gacaggagggagacccccacccacccccgaggcgatgacagcactgacggcagcgccgcc
gctcccgatgacgatggcaaggacgacgccaaggccgaggagctgggagccgacgagccc
aaggattccccagaccgcggggactctgaaaaaccagccaccccgggtgagggagcgcta
agctccgacctcgacaagatccccacggaagagctgcccaagatggagagcaaggacgtg
cagcagctcttcaaggacgtgctgggctcggcggagcgcggggagcagcccctcaactgt
gtggccgcggggatggaggccgggcaggaccccagccgagcacagcggcccttcctgcaa
ggagacctgcccctgggctcactctccggatctgtctccttggactcgtactcgggagtc
tgccagtccccattcctcgataacagggagcggagtggcttcttcagcccagaccactgc
gagcctgagagcccctgggccagcagctcggccgccaccaccccctcgacccccacgacg
cccacaacggagggcgagggcgacgggctgtcctacaaccagcgcagtttgcagcgctgg
gagaaggacgaggagctgggtgagctctccaccatctcccctgtcctctacgccaacatg
aacttccccaacctcaagcaggattatccagactggtggagccgctgcaaagagatcatg
cagctctggcggaaaccccccatgcgcttcaccttccccccggccgtctcggagccgctc
aagggctccccatcccaccagccccacgggatcaacagccattacggctctgggaagccc
cagagctcggcctacgcctcgtcccccagctttcaccagcccccggcgcccccgcagcag
caggacccttctggagccttcctgccccgcactgcgctgggactgacggccgacaagagg
gaggaggtggctgcagggctctcagcacccccaaatcgggacctggcagagctgcctggt
gcccaggatggggctctgggcaccatgagccagtcagagctggagaagcagcggcagcgc
cagcggctccgggagctgctcatccgccagcagatccagaggaacagccttcgagagccc
gcctgcggctgcctcctcctcaccagcgggctggccgctggcacccccatgggcagcctg
ggcgcccgcctgcccacccctgccgaggccgtgcccccctcaccagctgccctgggcgct
cccttcatcgagctccgacacaacgtgcagaaaggacctggcggtgtcgtgggatctccc
tttgccccccaggcaccccggcctcgattcttcctgcccggggaggagggcaccccccag
gccctgtgcacccctgtcatgcccctgcaggctctgccaacccagaaggttccagcaccg
ctgccacccgcgtccccgcagggagccgagatgggcaacagccaccagcagccccacgcc
aaggtggcacctccactgccagcgcccaccctggagctgcagcagcacatccccccacgc
cccctgtcctccggtgccaccctgcgccctgagggtgccaaggatggccccgctccagac
cctgcaccggcccctgggaaaagccacctgagcctggaggggggacggctgccctgcgag
gtgcccgtggagcctgatctggatgacgacttcggctcccacaaggacttggaagatgat
gatgatttggccaaccttagcctggatccagatgtggccaaaggggatgatgacttggac
aacttggacagcctggagacagcagacccccacctggatgacctgctgaatggcgatgaa
ttcgacctgctggcctacactgaccccgagctggacactggtgacaagaaggacatcttc
aacgagcacctgcgcctggtggagtcggccaacgagaaggcagagcgtgaggcccagctc
aagacagaaccaccagcgcccaccttgaagctccctgaccctggggacagcaaagatggt
gcagaggcaaaggccggctcgctgcccactgatgtcaagcccaaactggaggatggctgc
ctgaagacctcaccctgccagttcaccaccgctggcccccccatcaagtcagaagcactg
cagggcacagataaaatctctgcctccctggggctgagtgtcaaacctggccagaccctc
ctgagctccagcaccggccccactcgcctcggcatgactcagttctccaacagtggccat
gctggtgtccccgtgctggagaaggacccctacaccggccctggccgtgggctggcaact
gcccagctgggtggccagagcaaccccttgctggagaagtttgagctggacagcggagct
ttggggctgggcagtgcccggcactcgccagcagatgacctggacaagatggagagctcg
ttggtggccagcgagctgcccttgctcatcgaggacctcctggagcacgagaagaaggag
ctgcagaagaagcagcagatgtcggcccacctgccccgtggcaccccgcacctccaagcc
ccggggcaccccatgctgcacacaggggcatctgggcagcctcccgaggggcagccgccc
cgtctgggcacccctcagactcccctccagctggggctggtggcccggccacctctgctg
ccaccacagcccccccggctcggcgcaccccagcagggcccagctctggccccccacatg
ggcatgggctctgggcagccccacgtgctgtcatccccccacggggtgcaggtggccctg
gggcagccacagcagagtcagcagcaggtgctggtgcagaagccgatggccggggtgcag
ccccccagtctgggtctgaagcccccccagctcgtcatgcagcagcagttggccaacagc
ttcttcccagacacagatctggacaagtttgcagctgaggacatcatggaccctattgcc
aaggccaagatggtggcactgaagggcatcaagaaggtgatggctcagggcagcatcggg
gtggccccaggcatgaacaggcaacaggtttccctgctggcccagcggctctcggggggc
ccggctgtctctgagatgcagaaccacttattggcagggagcgggcaggagcggagtggc
acggacccgacccaggctcgccccaacccacccacctttgcacagggcgtcatcaacgag
gccgaccagcgccagtacgaggagtggctgttccacacgcagcagctgctgcagatgcag
ctgaaggtgctggaggagcagatcggggcgcaccgcaagtcccgcaaggcgctctgtgcc
aagcagcgcacggccaagaaagccgggcgggagttccccgaggctgacgccgagaagctg
aagctggtgacagagcagcagagcaagatccagaagcagctggaccaggtgcggaagcag
cagaaggaacacaccaacctcatggctgagtaccgcaacaagcagcagcagcaccagcac
caggcctcagccgtgatggccctgagcccctcgcagagcccccgcctcatgtccaagctg
ccgggacagctcctgtcagcacacggcgtgcagcagcctggaggagccctgggaatgcag
ccgaccccggcggtcctggctgccaaggaccagcccgcggggatggacggcagcgccctg
cacgctgagggtggtgagagtgggagggagctgcacggggagcagcagggagccctgaac
cccccggggctgggggagccccaggcccccaagcaccaggctgagctagggcagggccag
cagctcctcttgagctccccacagccgggtgttatgcgggcagcccccgggcagccaggt
gccctgctcgccccaacgctgcagagccctggggctgtccatgccgagctgtcccagcag
cacggggacacggctgggggggcagaacaacccctgggctgtgggacaggcccagcacag
gccatggtgccggcaccgcggcccccagagcagccaggcaagggggtggcgggggccctg
ccaggacagccacagcccccacggctccagagccccgttcagcacaaagttgggccagcg
tcgggcacggccactctccccccaggtctgctggggcaggtgccggggccggtgatgggg
cagatccgggcgcagctccagggtgtcctggccaagaacccgcagctgcggcatctgacg
ccgcagcagcagcagcagctccaggccctcctggtgcagcggcaccagcagagcctgctg
cagcagaaccaggcactacggacccctggccccttccccgggcaggccccggattacagc
ttgcccgcgacccgccagccccctcgtcccatggggtcccttttccagccccgggcagac
gccccaacagaggcacagagcagctctgccaccgaggcggggcgggccctgccagggcag
cctccccagcagcccccggctgagctggttcaggcagctctggctgcccgtggcccccag
cccggcctcatccgcctccccacgccaccggccccctcacccctgggctgtgccccccag
cacctggccagccccgagcagagcccccaagagccaaagaagacatcaccggggatcccg
gccttggcccccagccctgcggcacccacggagccagggctgactcccacgccaagcggg
gccctccctgacccagcacacggcccctgggaccccgaggcacctggggtggacccagct
gaccctgctgagacccgcatcaatggggctgtgccagagggggctcctgcagcaggtgaa
gccccccaggtgttggtgaagcaggagccaaaggaagaggctgcagcagtggcacagtgt
gaggtggatggagacgagacagcaaaaccagaggccaatggggaccctggggacaaccaa
gccaacagcctgctggcgccaggtgggcgctccgaggctgggcacctgctgctgcagaag
ctgctgcgggccaagaacgtgcagctctcagctcagagcccaggcgagctcaatgggcac
atggagaaccggagcgctggggcagagccacggccacagtcgctgctgctgggccgggag
gacccctccattgccaggaagccagcgcccaccaagcctaagcgggtgcagaaaggcaac
gagcggatcccagcgtcccgcaagaagctgcgcaaggatgaggggctgcgtcctggcgag
gccctcatgaagcagctgaagcaggagctgtcgctgctgcccctgactgagcccaccatc
atggccaacttcagcctcttcgcgccctttggcagcagccccatcaacgggaagagccag
ctgaggggcaccttcggcagtgctgtgctcgacagcgtccctgactactactcccagctg
ctcaccaagaacaacctcagcaacccacccacgccaccctcctcgctgccccccacaccc
cctccctccgtgcagcagaagatggtgaatggtgtcacggcccctgaagagctgggggag
cagcccaaggacgccgacccagcccgtgagccccacagccagaaagctgtggaggtgaag
agcctggacctgctggcagcactgccaacccctccacacaaccagaccgaggacgtcagg
atggagagtgacgacgagagcgactcccccgacagcatcgtccctgcttcatcccccgag
agtgtcctgggcgaggagctgctccgcttcccactgctcagcgaagccaagccagagctg
gaggagcgtgtgctgtcccccatcatccccatcatcccccgggccagcatcccagtgttc
cccgacacaaaaccctatgaggccgcagagccctttggggctccaccagggaaggtggga
gcagcaggccctggagccccgtgggagaagggcaagagcagcgaggtctccgtcatgctg
acggtgtctgcagcagctgccaagaacctcaatggggtgatggtggccatggctgagctg
ctgagcatgaagatccccagctcctacgaggtgctgttccccgacggccctgtgcgagca
gccgtggttgaggccaagaaggtggagactgatatggctggaatgctcggagggaaggag
aaggccctggctgggaaggtgccggacagcagctcggagtggctgaagcagtttgatgcg
gtgctgcccgggtacagcctcaagggcgagctggacctcctgacgctgctcagacaggag
agccctgctcctgagaagacccttcaccactgctacgtcaacaacgtctccaacctggac
gtgcggcagctctctgtcctgccccaggaaccctcgcccccgctgtccccccgttccaag
ccacgctcgcggcctctggaggatggggatgaggcgaggccgcggctgaagaagtggaag
ggggtgcgctggaaacggctgcgcttcctcgtcaccatccagaaagggggagccaagcgt
gacggggacaaggagatcgccgagttcatcgacaagctgggaaccacgctgcgccccgag
aaggtgccgcaggacatgcgcaagtgctgcttctgtcacgaggagggcgacggggccacg
gacgggccggcccgcctgctcaaccttgacctcgacctctgggtccacctgaactgcgcc
ctgtggtccacggaggtgtacgagactcagggaggggccctgatcaatgtggaggtggcc
ctgcaccgtgggctgctcaccaagtgctccctgtgccagaaaactggcgccaccaacagc
tgcaaccgcatccgctgccccagcgtgtaccacttcgcctgcgccatccgcgccaagtgc
atgttcttcaaggacaagaccatgctgtgtcccctgcacaagctgaaggggccctgcgag
caggagctcagcagcttcaccgtgttccgccgcgtctacatcgagcgggacgaggtgaag
cagatcgccagcatcatccagcgcggcgagcggctccacatgttccgcgtgggcggcttg
gtcttccacgccatcgggcagctgctgccccaccagatggccgatttccacagcgtcacg
gcgctctaccccgtgggctacgaggccacgcgcatctactggagcctgcggaccaacaac
cgccgctgctgctaccgctgcaccatctgcgagaacaacgggcgccctgagttcgtcgtg
caggtcatcgagcagggcctggaggatcttgtcttcactgactcctcgccacaagctgtc
tggaacaggatcatcgagccagtggcgatgatgaggaaggaggccgacatgctgcgactc
ttccccgagtacctgaagggcgaggagctctttggcctcacggtgcatgcggtgctgcgc
atcgccgagtcgctgccgggcgtggagagctgccagaactacctgttccgctacgggcgc
catcctctgatggagctgcccttgatgatcaatcccaccggctgcgcccgctccgagccc
aagatcctcacccactacaagcggccccacaccctgaacagcacaagcatgtccaaggcc
taccagagcacgttcacgggcgagaccaacacgccctacagcaaacagtttgtgcactcc
aagtcctcccagtaccggcgcctgaagacggagtggaagaacaacgtgtacctggcgcgg
tcccgcatccaggggctggggctctacgcggccaaggacatcgagaagcacacgatggtc
atcgagtacatcggcaccatcatccgcaacgaggtggccaacaggcgggagaagatctat
gaggagcagaaccgcggcatctacatgttccgcatcaacaacgagcacgtcattgacgcc
acgctgacggggggcccggccaggtacatcaaccactcgtgtgccccgaactgcgtggcc
gaagtcgtgaccttcgacaaggaggacaagatcatcatcatctccagccggcgcatcccc
aagggggaggaggtcagaaccaggcggaaccgggaccgggagtggttccgagaaccgggt
ggaaccgggaacggggccggagtggttcccagaaccgggcggaagcagggcaagaaccgg
gaccgggagccgagcggaaccggcaccaggaacccaacgggactgggaacggggcgggag
tga

DBGET integrated database retrieval system