KEGG   Geospiza fortis (medium ground-finch): 102034159
Entry
102034159         CDS       T03755                                 

Gene name
CDK6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
gfr05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102034159 (CDK6)
   04115 p53 signaling pathway
    102034159 (CDK6)
   04218 Cellular senescence
    102034159 (CDK6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102034159 (CDK6)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102034159 (CDK6)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102034159 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2 Seadorna_VP7
Other DBs
NCBI-GeneID: 102034159
NCBI-ProteinID: XP_005418633
UniProt: A0A6I9HET1
LinkDB
Position
Un
AA seq 326 aa
MDKDSTNLADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSAIR
EVAVLRHLETFEHPNVVRLFDVCTMSRTDRETKLTLVFEHVDQDLTAYLDKVPEPGVPTE
TIKDMMLQLFRGLDFLHSHRVVHRDLKPQNILVTSNGQIKLADFGLARLYSFQMALTSVV
VTLWYRAPEVLLQSSYATAVDLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFDVIGLPEE
EDWPNDVALPRNAFTSRPAQPIEKFVPDIDEVGKDLLLKCLAFNPAKRISAYVALSHPYF
HDLEKFKENLDCHMSSSQNSSEVNAS
NT seq 981 nt   +upstreamnt  +downstreamnt
atggataaggacagcacaaacctggctgaccagcagtatgaatgtgtggctgagattggg
gaaggagcctatgggaaggtgttcaaggcccgagacttgaagaacggaggtcgctttgtt
gcgctgaagcgggtgcgggtgcagaccagcgaggaggggatgccgctgtccgctatccga
gaggtggcagttctgaggcacctggagacgttcgaacaccccaacgtggtcagattgttt
gatgtgtgcaccatgtcacgaacagacagagagaccaagttaacattggtgtttgaacat
gtggatcaagacttgactgcttacttggataaagttccagagcctggagtacctactgaa
actataaaggatatgatgcttcagctgtttcggggactggattttctgcattctcatcgt
gtagtgcatcgggatctgaaaccccagaatatccttgtaaccagcaatgggcagataaag
ctagctgattttggccttgcacgactctacagttttcagatggctcttacctcagtggtt
gttactttgtggtatagagctcctgaagtcttgcttcagtccagttatgcaacagcagtt
gatctttggagtgttggctgcatatttgcagaaatgttccgtcgaaaaccactcttccgt
ggaaattcagatgttgatcaactaggaaaaatctttgatgtcattggactcccagaagaa
gaggactggcctaatgatgttgcccttccaagaaatgcttttacttccagacccgcacaa
cctattgaaaaatttgtaccagatatcgatgaagtaggcaaagacttgcttcttaaatgc
ttagcgttcaacccagccaaaagaatatctgcatatgttgccctttctcacccatatttc
catgatctggagaaattcaaggagaatctggactgtcacatgtcatccagccaaaactcc
agtgaggtgaatgcatcataa

DBGET integrated database retrieval system