KEGG   Geospiza fortis (medium ground-finch): 102034239
Entry
102034239         CDS       T03755                                 

Gene name
CDK1
Definition
(RefSeq) cyclin dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04110  Cell cycle
gfr04114  Oocyte meiosis
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
gfr04540  Gap junction
gfr04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102034239 (CDK1)
   04114 Oocyte meiosis
    102034239 (CDK1)
   04115 p53 signaling pathway
    102034239 (CDK1)
   04218 Cellular senescence
    102034239 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102034239 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102034239 (CDK1)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102034239 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     102034239 (CDK1)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102034239 (CDK1)
DNA replication proteins [BR:gfr03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102034239 (CDK1)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102034239 (CDK1)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102034239 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 102034239
NCBI-ProteinID: XP_005425609
UniProt: A0A6I9HMT8
LinkDB
Position
Un
AA seq 302 aa
MDDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELNH
PNIVCLQDVLMQDSRLYLVFEFLSMDLKKYLDSIPSGQYLERSRVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQIFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPVSLETHVKNLDKDGLDLLAKMLIYDPAKRISGKMALNHPYFDDLDKSTLPANLI
KK
NT seq 909 nt   +upstreamnt  +downstreamnt
atggacgattacacgaaaatagagaagattggggaaggtacctatggtgttgtgtataaa
ggtcgtcacaaaaccacaggccaggtggttgcaatgaagaaaatacgcctagaaagtgag
gaggaaggtgttccaagtactgctatccgagaaatttctttattaaaagagctgaatcat
cccaatatagtctgtcttcaggatgttctcatgcaggattcaagactgtacctcgtcttt
gaattcctttccatggatctcaagaaatatttggatagtattccctctggccagtatctg
gagcgttcacgtgtcaagagttatctgtaccaaattttgcaaggcattgtcttctgccac
tcaagaagagttctgcacagagacttgaaacctcagaaccttctgatagatgacaaggga
gtgattaaactggcagactttggactggcccgagcctttggaatcccagtgcgggtctac
acacatgaagtggtgacactgtggtacaggtctccagaagtgctgctgggatctgctcgt
tactctactcctgtagatatctggagcataggaaccatatttgctgagctggcaactaaa
aagccacttttccatggggattcagagattgaccagatcttcagaatcttcagagcttta
gggacccccaacaatgaggtatggcctgaggtggaatccctgcaagactataaaaataca
ttccccaaatggaaacctgtcagccttgaaacacatgtcaaaaacttggataaagatgga
cttgatctgctggctaaaatgttaatttatgatcctgcaaaaaggatttctggcaaaatg
gccttgaaccatccatattttgatgatttggacaaatccactcttcctgctaatctgatt
aagaaatag

DBGET integrated database retrieval system