KEGG   Geospiza fortis (medium ground-finch): 102034269
Entry
102034269         CDS       T03755                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04012  ErbB signaling pathway
gfr04020  Calcium signaling pathway
gfr04068  FoxO signaling pathway
gfr04510  Focal adhesion
gfr04540  Gap junction
gfr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102034269 (EGF)
   04012 ErbB signaling pathway
    102034269 (EGF)
   04068 FoxO signaling pathway
    102034269 (EGF)
   04020 Calcium signaling pathway
    102034269 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102034269 (EGF)
   04540 Gap junction
    102034269 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102034269 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gfr04052]
    102034269 (EGF)
Cytokines and growth factors [BR:gfr04052]
 Growth factors
  Growth factors (RTK binding)
   102034269 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3 DUF5050 SGL
Other DBs
NCBI-GeneID: 102034269
NCBI-ProteinID: XP_014167395
UniProt: A0A6I9ZEL8
LinkDB
Position
Un
AA seq 1238 aa
MFLFLVAFLPVVFKIGFVSLSALQHWNCPNGYRLKPENAACVDIDECLEGGLGTCGQTCI
NIPGSYICSCLPGYSLGIDKQSCYVNVFRIDTEGTNHERLVSDTGPSTLMDFHYIEEKVY
WVDSERRLLQRINLNGTKRERLCYIDKGISGFAIDWINQDILWANRQKGTIEATDMNGKK
RRVLLRAAGRPTRITIDAERRLLFLSSDGTVSSIHRASLSGSDMINILKTTEKIKAISLD
LVDTRLYWIQHDHGKEISHIGSCDYEGGAVRFLRNSVRHQLLGMSLFAEHLYYSDLKSGM
IWRANKYTGNVVVTISLKPSFFPPVEIKIVHPFKQPGARIDSQDLEKRICDWNREKCGRR
ICRPDLRTHWCKCSSGFILSRNKQFCEDINECGFWNHGCTLGCVNIPGSYYCTCPRGFVL
LPDRKTCHELITCASNDTGCSHGCLQTSKGPVCYCPEGSVLKVDGKTCTGCTSPDNGGCS
QICSSLSPSSWECACFPGYKLQQDRKHCTAIGPKPFLLFANGQDIRQISFDGTDYTSLLD
WQMGVVLALDSDPVENKIYFAHTALKWIERANLDGSDREKVIHGAMDTPEGLAVDWINRK
LYWTDRGKVCIERSNLNGMQRKMIIWEDLSQPRGIAIHPFAKRLFWTDMGVNPRIGSSSL
EGFDRRVVASTGLLWPSGIALDYLADKVYWCDAKQAVVESANLDGSGRRILAQNDVGHPF
AVAVFEDHLWFSDWARPSLVRVDKKTGQNRVRLRGSMLRPSSVVVAHPLAKPGANPCLYE
NGGCDQICENSFGIVHCKCFPGFVKTQGGKSCHALDSSNSTAGSASVHKEVMPMPPPETV
LQSTRSTGIFKDADNGEKQKIIFFTAEIMVSDEDDCTALECYDNAECVFLEDGAMCQCLK
GFTQKGKSCYDVDECAARTDRCNRSVSHCINTDGGYVCQCLGGYTGDGVHCYDIDECKTG
SHTCGENMTCTNTEGNFTCSCADHASGTGDGCKSTVPPAAVSSEHTTKAVQGDVVGCPPS
YESYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQHRAGRAKVRSIAITAXX
XGLALLYQLFNELLLFCCRSQNLYKKNLCAEAIRAASSRADNESVIPTGNNSLFAVFKEG
NSSLETKAVDLIECETADPHPACPSESEEEQPITCDKAAETLAEEEKEQGHQEEGEKSCQ
SMAAAKGSPQAPWSIHPNPPPEREPCNLAPASLLMQPD
NT seq 3717 nt   +upstreamnt  +downstreamnt
atgtttctcttccttgttgcttttttgccagtggtttttaaaattggttttgtcagcctc
tcagctctgcagcactggaactgtcctaatggatacagactaaagcctgaaaacgctgct
tgtgtagatattgatgagtgccttgaaggtggtttgggaacctgtggccaaacctgtatc
aatattccagggtcatacatctgctcctgtttgcctggctactccttgggtattgacaag
cagtcttgctatgtgaatgtctttagaattgacactgaagggacaaatcacgaaagattg
gtttctgatactggtccatcaacacttatggattttcattatatagaagagaaagtgtat
tgggtagactctgaaaggcgactacttcaaagaattaatctgaatggcacaaaacgagag
agactatgttacatagacaaaggcatttcaggatttgctattgactggataaatcaagac
attctctgggccaacagacagaaaggaaccatagaagcaactgacatgaatgggaagaaa
cgccgagttcttctgagagctgctggtcgtcccacaaggatcaccattgatgctgaacga
aggctgttatttttgtcttcagatggtacagtttccagcatacaccgagcgtccctcagt
ggaagtgatatgataaatattttgaaaactacagaaaaaataaaggccatctcactagat
ttggttgacacaaggctctactggatccaacatgaccacggaaaagagatttcccacatt
ggatcatgtgactatgaaggtggagctgttcgtttcctcagaaattctgtccgacatcaa
ttgcttggtatgtctctctttgctgagcacctgtactactcagacttgaagtctggcatg
atatggagagccaacaaatatactggaaatgttgtagtcacaattagcctgaagccatca
tttttcccaccagtggagataaaaatagtacatccatttaagcagccaggtgcaaggatt
gattctcaggatttggaaaaaagaatctgtgattggaacagagaaaagtgcggaagaaga
atctgcaggccagacttaaggactcactggtgtaaatgttctagtggctttattttaagt
cgaaataaacagttttgtgaagacattaatgaatgtggcttctggaatcacggctgcact
ttaggctgtgtgaacatccctggctcctattactgcacctgcccgagaggcttcgttctg
ctgcctgacaggaagacgtgccatgagctaattacctgtgcaagtaatgacactggatgt
agtcacggctgccttcaaacatccaaaggccctgtttgctattgcccagaaggatctgtg
ctcaaagtggatggcaaaacatgcacaggttgcacatctccagataatggtggctgcagt
cagatatgctcttccttaagcccatcctcctgggagtgtgcttgtttccctggatataag
cttcagcaagacagaaagcactgcactgctataggtcctaagccatttttgttatttgca
aatggccaagatatccgccagatcagttttgatggaacagattacacaagtttgcttgac
tggcagatgggagtagtcttagctctggactctgacccggtggaaaataagatttacttt
gcccacactgccttgaaatggatagaacgagctaatctggatggctcagatcgtgaaaag
gttattcatggagctatggatacacccgaaggccttgctgtggactggattaaccgtaaa
ttgtactggacagacagagggaaggtgtgcattgagaggagcaatctgaatggaatgcaa
agaaaaatgatcatctgggaggatctctcccagccccgagggattgccattcacccattt
gctaagagattattctggactgacatgggggtcaacccgaggattggcagctcttcgtta
gaaggctttgatcgccgggttgtagccagcactggtctgctgtggcccagtggaattgct
ctggactacttggctgacaaggtgtactggtgtgatgctaaacaggccgtggttgagagc
gcaaacctggatggttctggtcgtcgaattcttgcacagaatgatgtagggcaccctttt
gctgtagcggtgtttgaggaccatctgtggttttctgactgggctaggccatcactggtg
agggtggacaagaagaccggccaaaacagggtacgtctgcgaggcagcatgctgagaccc
tcatcagtggttgtagctcatcctttggcgaaaccaggtgcaaatccttgcctttatgag
aatggaggctgtgatcagatctgtgaaaacagttttggcattgtccactgcaagtgcttt
ccaggatttgtgaaaactcaaggtggaaaatcctgtcatgctctggattcttccaactca
acagcaggaagtgcctctgtgcacaaggaggtgatgccaatgccaccaccagagactgtg
ctccagagcacacggagcactgggatctttaaggatgctgacaatggggaaaagcagaaa
ataattttttttacagctgaaatcatggtatcagatgaagatgactgcactgccctagaa
tgttatgacaatgcagagtgtgttttcctggaagatggtgctatgtgccagtgtttgaaa
ggatttacccagaaggggaaatcatgctatgacgtggacgagtgcgcggcacgcacggac
cgctgcaaccggagcgtgtcccactgcatcaacacggacgggggctacgtctgccagtgc
ctgggaggctacactggagatggagtccattgctatgatattgatgagtgcaagactggg
tcccacacctgtggagagaacatgacctgcacaaatacagaaggaaacttcacttgctcg
tgtgctgatcatgcttctggaactggcgacggttgcaaatctactgttcccccagctgct
gtcagcagtgaacacactacaaaggctgtgcaaggtgatgttgtaggatgccctccttcg
tacgagtcatactgcctccatggtggagtgtgcaattatgtttctgacctgcaagactat
gcctgcaactgtgtgacgggctacgtgggcgagcgctgccagttcagcgacctggagtgg
tgggagcagcatcgcgccgggcgggcgaaggtgcggagcatcgccatcaccgcnnnnnnn
naggggttggctcttctctaccagctattcaatgagttgcttttgttctgttgcagaagt
cagaatttgtataagaagaatctctgtgcagaagcgataagagctgccagcagccgcgct
gacaacgagagcgtaatacctactggcaacaactctctgtttgcggtttttaaggagggt
aacagttctctggagactaaagcagttgatctaattgagtgtgagacagcagatcctcat
cctgcctgtccttcagaatctgaggaagagcagcctataacatgtgacaaagcagcagag
actttggcagaagaggagaaagaacaaggccaccaagaagagggtgagaaatcgtgccag
tccatggcagcggcgaagggctctccccaggccccctggagcatccatcccaatccccca
ccagaaagggagccttgcaaccttgccccagccagcttgctgatgcagccagactag

DBGET integrated database retrieval system