KEGG   Geospiza fortis (medium ground-finch): 102034546Help
Entry
102034546         CDS       T03755                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102034546 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gfr03036]
    102034546 (SETDB1)
Enzymes [BR:gfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102034546 (SETDB1)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102034546 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102034546 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET TUDOR_5 Tudor_4 Pre-SET MBD DUF4537 XkdW Flavi_capsid YkyA
Motif
Other DBs
NCBI-GeneID: 102034546
NCBI-ProteinID: XP_014166438
LinkDB All DBs
Position
Un
AA seq 1214 aa AA seqDB search
MDCQDIKELQQEVMEELGISMEELREIIDKEVENSEWVRQRKQQLEELEQCMRHKEEEVA
HVDQLIDDAVRAMDKCEMLAKELYSMMGLQYRESSSEDEAPAATEVIEIPDEEDDDVMSV
DSGWKRSSLREAMAAMRKSARDVAKFMDAVNKKTNLQEAQKGVGASRSSPSNDLNTDGDL
KVGMRILGKKRTKTWHKGTLIAIQTVGAGKKYKVKFDNKGKSLLSGNHIAYDYHPSAERH
HVGRRVVARYKDGNQMWLYAGIVAETPNVKNKDRFLIFFDDGYASYVKEWELYPVCRPLK
KAWEDIEDVSCRDFIEEYITAYPNRPMVLLKNGQLIKTEWEGTWWKSRVEEVDGSLVKIL
FLEALPMGTSSVSFSFPQEDRRCEWIYRGSTRLEPMFSMKTSTASTQEKKQSGQTRTRPN
VGAVRSKGPVVQYTQDLAGAGPQYKTPEPAARPTSPQPAEMECSDTQLAQGRKQVAKKST
SFRPGSVGSGHSSPSSPVLGDTPAAARALPAPQHRVRSDQYRSRNPLLIPLLYDFRRMTA
RRRVNRKMGFHVLYKTPCGLCLRSMHEIERYLFETDCDFLFLEMFCLDPYVLVDRKFQPY
KPYYYIADITKGKEDVPLSCVNEIDSTPPPQVAYSKERIPGKGVYINTSWEFLVGCDCKD
GCRDKSRCACHQLTIQASGCTPGGQINPNSGYQHKRLEECLPTGVYECNKRCKCNVNMCT
NRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEY
FANLDHIESVENFKEGYESDAKCSSDNSGVDLKDDDDDEENTGTEELEESNEDSSDDNFC
KDENFSTSSVLRSYATRRQTRGQRDHGPSETASKDSGLTRPPSHEEPTTAPPCKLPVSEE
ISKNKVASWLSSNSVAESLQDSNDASSFRVGEGGETKAVKMEMPAEREKGCASTPGDLNG
EAKAPKKEEPEESTKIPGGSSLGRRYGYNPCPPRLEGIRRPISGTVLLQSRRRSLAPPPP
SENVLLVSSSTDSEEEHRAGQAPGAANDSDDIQTISSGSEEEEGEDKKNPSSGSGPVKRQ
VAVKSTRGFALKSTHGIAIKSTPLAAADKGESAGPVRRSTRQFYDGEENCYIIDAKLEGN
LGRYLNHSCTPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKEL
LCCCGAIDCRGRLL
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggattgccaggacatcaaggagctgcagcaggaggtgatggaggagcttggaatctcc
atggaggagctgcgggaaatcatcgacaaagaagtggagaattccgaatgggtgaggcag
cggaagcagcagctggaggagctggagcagtgcatgaggcacaaggaggaggaggtggcc
cacgttgaccagctcattgacgatgctgtgagggccatggacaagtgcgagatgctggcc
aaggagctgtactccatgatgggcctgcagtaccgggagagcagctcggaggacgaggct
ccagcagccacagaagtgatcgagatccccgacgaggaggatgatgatgtcatgagcgtg
gactcaggctggaaacgcagttcactgagggaagcaatggctgccatgaggaaatctgcc
cgggatgttgcaaaattcatggatgctgtaaacaagaaaaccaacttgcaggaagcacag
aaaggtgtgggagcttccaggagctcccctagcaatgatctcaacactgatggggacctc
aaagtgggcatgaggattttggggaaaaaaagaaccaagacgtggcacaaggggacgttg
attgccatccagacagttggtgctggcaagaaatacaaagtgaaatttgataacaaaggg
aagagtttgctctcgggcaaccacattgcctacgattaccacccatctgctgagaggcac
cacgtgggcaggagggtggtggccaggtacaaggatggcaatcagatgtggctctatgct
gggatcgtggctgaaacccccaatgtcaagaataaagacaggttcctgattttctttgac
gatggctacgcgtcgtacgtgaaggagtgggagctgtacccggtctgccggccactaaaa
aaggcctgggaagacattgaggatgtttcctgtcgggatttcattgaggaatacatcact
gcctaccccaaccggcccatggtactgctgaagaatgggcagctgatcaaaaccgagtgg
gaaggcacctggtggaaatccagagtggaagaagtggatggaagtctggtgaaaatcctt
ttcctggaagctcttcccatgggaacttcaagtgtttccttctccttcccacaagaggac
agacgttgtgagtggatttaccgaggttccacacgcctcgagcccatgttcagcatgaaa
acttccacagcttccacccaggaaaagaagcaaagtgggcagaccaggactcgtcccaac
gttggtgctgtgaggagcaagggccctgtggtccagtacacccaggatttagcaggagct
ggtccccagtacaagactccagagccagctgcacgtcccacgtctcctcagcctgcagag
atggaatgctccgacacccagctggcccagggcagaaagcaggtggccaagaaaagcact
tccttccgtcctggctccgtgggctccgggcactcgtccccatcctcccctgtccttggg
gacaccccagcagccgcgagggccctcccagccccgcagcaccgggtgcgcagcgatcag
taccgcagccgcaacccgctgctcatcccgctgctctacgacttccgccgcatgacggcg
cggcgccgcgtcaaccgcaagatgggattccacgtgctctacaaaacgccctgcgggctc
tgcctgcgctccatgcacgagatcgagcgctacctcttcgagacggactgcgacttcttg
ttcctggagatgttctgcctggatccctacgtgctggtggatcgcaagttccagccctac
aagccttactactacatcgcggatatcaccaagggcaaggaggacgtgcccctgtcgtgc
gtcaacgagatcgacagcacgccgccgccgcaggtggcctacagcaaggagaggatcccc
gggaaaggggtgtacatcaacaccagctgggagttcctcgtgggctgtgactgcaaggat
ggctgcagggacaaatccaggtgtgcctgtcaccagctgaccatccaggccagtggctgc
acccctggagggcaaatcaaccccaactcaggctaccagcacaagcggctggaggaatgt
cttccaacaggtgtttatgagtgcaacaagaggtgcaagtgcaacgtgaacatgtgcacc
aaccgcctggtccagcacggcctccaggtgcggctgcagctcttcaagacccagaacaaa
ggttggggcattcgctgcctcgacgacatcgccaagggctcctttgtctgcatctacgca
gggaaaatcctgacggatgactttgctgacaaagaggggctggagatgggtgatgagtac
tttgccaacctggaccacatcgagagcgtggagaacttcaaggagggctacgagagcgac
gccaagtgctcctcggacaacagcggcgtggacctcaaggacgacgacgacgacgaggag
aacacgggcacggaggagctggaggaatccaacgaggacagctctgatgacaacttctgc
aaggacgagaacttcagcaccagctcggtgctgcgcagctacgccacgcgccggcagacg
cgcggccagcgcgaccacggcccctcggaaacggcctccaaggactcggggctcacacgg
ccccccagccatgaggagcccaccacagcacccccctgcaagctgccagtgtctgaggag
atctccaagaacaaagtggcctcgtggctgagctccaacagcgtggctgagagcttgcag
gacagcaatgatgcctcgtccttcagggtgggtgaagggggagaaaccaaggctgtgaag
atggagatgcctgcagagagggagaagggctgtgcttccacgccaggagatctgaatgga
gaggcaaaggcacccaagaaggaggaacccgaagaatcaaccaaaattcctggggggagc
agcctgggaaggaggtacggctacaacccctgtcctcccaggctggaggggatccgcagg
cccatcagcggcacggtgctgctgcaaagccgccggcgatccctggccccaccgcccccc
tcagagaacgtgctgctggtgtcgagcagcaccgacagcgaggaggagcacagggcaggg
caggccccgggcgcagccaacgacagcgatgacatccagaccatttcctcaggatccgag
gaggaggaaggggaggacaagaaaaatccatcatctgggtcaggtcccgtgaagaggcag
gtggctgtgaaatccacccgaggcttcgccctgaaatccacccacggcatcgccatcaaa
tccacgccgctggcggcggccgacaagggcgagagcgcggggcccgtgcggcgcagcacg
cggcagttctacgatggcgaggagaactgctacatcatcgacgccaagctcgagggcaac
ctgggccgctacctcaaccacagctgcaccccaaacctgtttgtgcagaacgtttttgtg
gacacccacgaccttcgcttcccctgggtcgccttctttgccagcaagaggatccgagct
ggcacggagctgacctgggattacaactacgaggttggcagcgtggagggcaaggagctg
ctgtgctgctgcggggccatcgactgccggggccgcctgctctga

DBGET integrated database retrieval system