KEGG   Geospiza fortis (medium ground-finch): 102034616Help
Entry
102034616         CDS       T03755                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00052  Galactose metabolism
gfr00500  Starch and sucrose metabolism
gfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102034616 (GANC)
   00500 Starch and sucrose metabolism
    102034616 (GANC)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102034616 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 102034616
NCBI-ProteinID: XP_005419588
LinkDB All DBs
Position
Un
AA seq 906 aa AA seqDB search
SSVQDEAVDKSNFKKCNQIAFYRRQKLLRPGKSLYRVLLDSVTLSDENVKFQIIHEGNKV
LLQVEIYEIEGNIFRLKIDEASPLRPRYKVPDVLIKEPTTQRLLISHKEAGILVLSSVNE
DYKLRVTANPFQVELQSKGETVMSVNSNGLLYFEHLQPPPSDRKPTAQNEEAASDXXQEK
QEDLGLWQEKFGSFLDIKAHGPTSVGMDFSLHGYDHVYGIPQHTETLLLKNTSDGDAYRL
YNLDIFGHKIHEKIGIYGSVPLLLAHKPNRTSGIFWLNSSETLVDISTKAVAEHTPSRSA
AETAKQRAVPLTDVRWMSESGIIDVFLLMGPTAFDIFKQFAQLTGTQALPPLFSLGYHQC
RWNYEDEQDVKAVDAGFDAHDIPYDVIWLDIEHTDGKRYFTWDKKKFQNPRKMQEHLRKR
KRKLVVIVDPHIKVDPSYILYAQAKEKGYFVKDRNGQDFEGICWPGSSCYPDFTNPDVRK
WYADQFAFKTYKGSTNILFVWNDMNEPSVFKGAELTMQKDAVHYNNWEHREVHNLYGFYQ
QMATAEGLIRRSSGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIPMLLTINMA
GISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHSNMESKRREPWLFGEKNTQIIRK
AITERYVLLPYLYTLFYRAHTAAEPVMRSLWIEFPGKMETFDVENEYMLGNALLVHPVTE
KEAKTVTVLFPGSEEIWYDFRKFKRMEDAGTVKIPVTLENIPVFQRGGTVIPLKTSAGKS
TEWMIDISYELHVALDAEACAIGELYVDDGHSFQYLHKKQFLYRKFTFHKNILSSSCVDE
SGQYHTTCVVERAIILGFGKQPTFVTASAKDGKKKEVVFTYDTKTSALTLENLALSVDAD
WEICIS
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
tccagtgtccaagatgaggctgtggacaaaagcaactttaagaaatgcaaccagattgct
ttttacaggcgtcagaaacttctacgtcctggaaaatccttgtatcgagttttgttggat
tcagtcacattaagtgatgagaatgttaaattccaaatcattcatgaggggaataaggtt
cttctacaagtagaaatttatgaaatagaaggcaatattttcaggcttaaaattgatgag
gcatctcctctcagaccaagatacaaagttcctgatgttcttataaaggaacctaccacc
cagagactgctcatatcccacaaggaggcaggtattttggtactgtcaagtgttaatgag
gactacaaacttcgagtcacagcaaaccccttccaagttgagctgcagtccaagggtgag
actgttatgagtgtgaattccaatggtttgttgtattttgagcacctacaaccacctccc
agtgacagaaaacctacagcacaaaatgaggaggcagcaagtgatnnnntacaggaaaaa
caagaggatctaggtctctggcaagagaaatttggcagtttcttggacatcaaagctcat
ggtcctacttctgtaggcatggacttctctttacatggatatgaccatgtttatggaata
ccacaacacacagaaacccttcttctcaaaaacaccagtgatggtgatgcataccggctt
tataatttggatattttcggccacaagatacatgaaaaaataggtatttatggttcagta
ccccttctcttagcacacaagcctaacagaacttcagggatcttctggctgaactcttca
gaaacactggtggatattagtacaaaggcagtagctgagcacactccatctagatctgct
gcagagactgctaagcagagagcagtgcctctaactgatgtacgctggatgtcagaaagt
gggatcattgatgttttcctgctgatgggacccactgcatttgatatcttcaagcagttt
gcacaactgacaggcactcaagccttgcccccgcttttttctctgggctaccatcagtgc
aggtggaattatgaggatgaacaagatgtcaaggcagtggatgctggctttgatgcacat
gacattccttatgatgtcatatggctggatatagagcacacagatggcaagaggtatttt
acttgggacaaaaagaaattccagaaccccagaaagatgcaagaacatctcaggaagaga
aaacgcaagcttgtggtcatcgtagatcctcatattaaggttgatccctcgtatatcctg
tatgcacaggcaaaagaaaagggatattttgtaaaagacagaaatgggcaagattttgag
ggcatctgttggccaggttcctcttgttacccagatttcaccaatcctgatgtgcgaaaa
tggtacgcagatcaatttgccttcaaaacatacaagggatccactaatatcctctttgta
tggaatgatatgaatgagccttcagtcttcaagggggcagaactaacaatgcagaaagat
gctgtgcactacaacaactgggagcatcgggaagtacacaacctctatggattctaccag
caaatggcaactgcagaaggactcatcagacgttcttcaggaaaagagaggccatttgtc
ctcacacgatctttttttgctggatcacagaagtatggggcagtgtggactggagacaac
acggcagagtggagttacttgaaaatatccattccaatgcttcttaccatcaacatggca
gggatttccttctgtggagctgatgtgggagggtttattggagatccagagccagagtta
cttgttcgctggtatcaggcaggagcctaccagcccttcttcagaggtcactctaacatg
gagagcaaacggcgcgaaccgtggctctttggggagaagaacacccagatcatcaggaaa
gccattacagagcgctacgtcctcctgccctacttatacactctgttctatcgggctcac
acggcggctgaacctgtcatgaggtctctctggatagagtttccagggaaaatggaaact
tttgatgtggaaaatgagtacatgctgggaaatgctttgttggtgcatccagtcacagag
aaagaggccaagacagtaacagttctgtttccagggtcagaggagatttggtatgatttc
agaaaatttaagcgaatggaagatgcgggcacagtgaagatcccagtaacactggagaat
attcctgtattccagcggggaggcactgtgatacctctgaagacctcagctggaaaatcc
actgaatggatgatagatatttcttatgaactccacgtggccttagatgcagaggcctgt
gccataggtgagctctacgtagatgatgggcattcatttcaatatctccacaagaagcag
ttcctgtatcggaaattcactttccacaagaacattctctcttccagctgcgtagatgaa
agtggacaataccatactacatgtgtagttgaacgggcgataattctgggatttggaaag
caacccacttttgtgacagccagtgccaaggatgggaaaaaaaaggaggtggttttcaca
tatgatacgaagacctctgcactgacactggaaaacttagccctgagtgttgatgctgac
tgggagatctgtatcagctga

DBGET integrated database retrieval system