KEGG   Geospiza fortis (medium ground-finch): 102034695
Entry
102034695         CDS       T03755                                 

Gene name
TP73
Definition
(RefSeq) tumor protein p73
  KO
K10148  tumor protein p73
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102034695 (TP73)
Transcription factors [BR:gfr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102034695 (TP73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 102034695
NCBI-ProteinID: XP_005427706
UniProt: A0A6I9HPQ3
LinkDB
Position
Un
AA seq 658 aa
MKDWRWIPLQKVIYPLSDSPALKMSQPSPADEGPTFEHLWSSLEPDSTYFDLPPANPSSS
NEVSNSTEVTMDVFQMRGMTDSVMSQFNLLNSSMDQSIGSRAASTSPYSSEHTSNVPTHS
PYSQPSSTFDAMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAK
TCPIQIKVSTSPPPGTIIRAMPVYKKAEHVTEVVKRCPNHELGRDFNDGQSAPASHLIRV
EGNNLSQYVDDPVTGRQSVMVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITL
ETRDGQVLGRRSFEGRICACPGRDRKADEDHFREQQALNESTAKNGNANKRTFKQSPQGI
PALGTGIKKRRHGEEEMYYVPVRGRENFEILMKIKESLELVELVPQQLVDSYRQCDQSVP
SPNRTQLQTPSSYGPVLSPMNKVHGGGINKLPSVNQLVGQPAQHGSSSAPSLGPMGPGML
NSHPMQSNGEMNGGHSSQSMVSGSHCTPPPPYSADPSLVSFLTGLGCPNCIDYFTSQGLQ
NIYHLQNLSIEDLAALKIPEQYRMIIWRGLQELKQSHDYGAQQLIRSSSSNASTISIGSS
GELQRQRVMEAVHFRVRHTITIPNRGTADDWADFGFDLPDCKSRKQSIKEEFTEGEIN
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgaaggactggcgctggatcccgctgcaaaaggtgatctatcctctgtcggactcccct
gctctgaagatgtcccagccatccccagctgatgaaggccccacctttgagcacctctgg
agctcgctggaaccagacagcacctacttcgacctgcctccagccaaccccagcagcagc
aatgaggtctccaacagcacagaggtcaccatggacgtgttccagatgagaggcatgact
gactcagtgatgtcccagttcaatttgctgaacagcagcatggatcagagcatcggcagc
agagcagcctccaccagcccctacagctccgagcacacctccaatgtcccaacgcactcg
ccctactcgcagcccagctctaccttcgacgctatgtccccggcgcccgtcatcccctcc
aacaccgactaccctggtccccaccacttcgaggtgaccttccagcaatccagcaccgcc
aaatcagccacctggacctactccccgctgctgaagaagctctactgtcagattgccaag
acatgccccatccagatcaaggtgtccacctcaccacccccgggcaccatcatccgggcc
atgcctgtctacaagaaggcagagcacgtcaccgaggtggtgaaacgctgccccaaccac
gagctgggccgcgacttcaacgacggccagtcagcccctgccagccacctcatccgggtg
gaaggcaacaacctgtcccagtacgtggatgaccctgtgacggggcggcagagcgtgatg
gtgccctacgagcccccgcaggtggggaccgagttcaccaccatcctgtacaacttcatg
tgcaacagcagctgcgtgggagggatgaacaggaggcccatcctcatcatcatcaccctg
gagacgagagacgggcaggtcctggggaggagatccttcgaggggcggatctgtgcctgt
cccggcagggacaggaaagctgacgaggatcatttccgagagcagcaagccctgaacgag
agcacggccaagaacggcaacgccaacaagcgcaccttcaagcagagcccccagggcatc
ccagcgctgggcactggcattaagaaacggaggcacggggaggaggagatgtactacgtg
cctgtgcgaggccgggagaactttgagatcctgatgaagataaaggagagcctggagctg
gtggagctggtcccacagcagctggtggattcctaccgccagtgtgaccagagtgttccc
tccccaaacaggacccagctgcagacaccttcctcctacggccccgtcctttcccccatg
aataaagtccacggaggaggaatcaacaagctgccctctgtgaaccagctggtggggcag
cctgcccagcacggctccagttctgcacccagcctgggccccatgggacccggaatgctg
aacagccaccccatgcagagcaatggagaaatgaacgggggccactcctcccagtccatg
gtgtcggggtcacactgcaccccccctccaccctacagcgccgaccccagccttgtcagt
tttttaacaggattggggtgtccaaactgcatcgactatttcacctcacaagggttacag
aatatttaccacctgcagaacctatccatagaggatctcgcggcactgaagatcccggag
cagtaccgcatgatcatctggcggggcctgcaggagctcaagcagagccacgactacggg
gcccagcagctgatccgctccagcagcagcaacgcctccaccatctccatcggcagctcg
ggcgagctgcagcggcagcgggtgatggaggccgtgcatttccgcgtgcgccacaccatc
accatccccaaccgcggcaccgccgacgactgggccgacttcggcttcgacctcccggac
tgcaaatcccgcaaacagtccataaaggaggagttcacggagggagagatcaactga

DBGET integrated database retrieval system