KEGG   Geospiza fortis (medium ground-finch): 102034861Help
Entry
102034861         CDS       T03755                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gfr01002]
    102034861 (TMPRSS9)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102034861 (TMPRSS9)
Peptidases [BR:gfr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102034861 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 102034861
NCBI-ProteinID: XP_014165082
LinkDB All DBs
Position
Un
AA seq 1124 aa AA seqDB search
MDQTKPGQGTQRRRLGACWKVTAAAAMAGSATALCLGILLACHSTGEASFEHTVELQGIL
FNSSLQTENSDYYRVLTPALERLFLSSLQDSQLNWTCTGCTILGYSRNGNSSVIVHFRLL
FTPQDSQPLNSTLEEEAFRHGLAAALHKQGFSLAAYGTISSASLTGPNKVSSHRPGLKSG
SCPWDTGLLQHPVCXKESPECDSQTGCADASDGRGCAESPTADCGSRPAMQTASRIVGGS
EASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQDPAMWAAYTGTTSLRGSD
GSAVKMDISQIIPHPSYNADTADYDVAVLELKRPVTFTKYIQPVCLPDAGHHFPTSKKCL
ISGWGYLKEDFLVKPEFLQKATVELLDQNLCSSLYSHVLTDRMMCAGYLEGKVDSCQGDS
GGPLVCQEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTKLRDWILDAISAFPTSIAHTVP
PVHFRTNSNMVSAEEVNTTTGATPTTLPAPAASRPGAAAGPQECGGRPGFSKPSKIVGGT
DASRGEIPWQVSLKEDSRHFCGATIIGDRWLLSAAHCFNETMPEEIEAYVGTTSINGTDE
NAVKVNVTRVIPHPLFNPMILDFDVAVLELARPLVFNKYIQPVCLPLAMQKFPVGKKCLI
SGWGDLQEGNDTKPEILQKASVGIIEQNTCNFLYNFSLTDRMICAGFMEGMVDSCQGDSG
GPLACEVTPGVFYLAGIVSWGFGCAQAMRPGVYSRITKLTDWILDIISQLPSGGTSIPSS
SAIPTTSSTAIFIQPSTMAAGPASRTTLQTKMSTTMSETSTALRTTETAKPTQTPVVPCT
SLTFKCSSKVCIGKENPECDGVVDCSNGFDERNCDCGSTTALAFSKIVGGSSAARGEWPW
QVSLWLRRKEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAYLGTPFLSGIDGKMEKIFR
IYKHPFYNVYSLDYDVALLELSTPVTFSSTIRPICLPDNSHIFHEGARCFITGWGSTKEG
GLMSKHLQKAAVNMIGDQACKKFYPVQISSRMLCAGFPQGTVDSCSVSARAGDAGGPLAC
KEPSGKWFLAGITSWGYGCARPYFPGVYTKVTAVQGWIVQNLKL
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggaccagacaaagccagggcaaggcacccagaggaggagactgggggcctgctggaag
gtaactgctgctgctgccatggcaggcagtgcaacagccctctgcctggggatcctgctg
gcctgccattccacaggagaggccagctttgagcacacagtggagctgcaaggaatcctg
ttcaatagcagcttacagacagagaactcagactactacagggtgctgacacctgctctt
gagaggctgtttctgtccagtctccaggactcccagctgaactggacttgcactggttgc
accatcctgggctacagtaggaatggaaactccagtgtgatcgtccatttccgcctcctc
ttcaccccccaggattcccaacctctgaactctaccttggaggaggaagctttcaggcat
gggctggcagctgccctgcataagcagggtttctccctggctgcctatgggaccatctcc
tcagcctctctcacaggtcccaacaaggtttcttcccacagacctggactgaaatcaggg
agctgcccttgggacacaggcttgctccaacatccagtatgtngaaaagaaagccctgaa
tgtgacagccaaacaggctgtgctgatgcctctgatggaaggggctgtgctgaatctccc
acagcagactgtgggagtcgtcctgccatgcagactgccagcaggatagtcggaggctca
gaggcatccagaggggagttcccatggcaagtcagccttcgagagaacaatgagcacttc
tgcggtgctgcaatcctcacagagaagtggctggtgtctgctgctcactgctttactgag
tttcaggacccagccatgtgggcagcttacacagggaccacttccctcagaggctcagat
ggcagtgcagtgaaaatggacatttcacagatcatcccacacccctcttacaatgctgac
acagctgactatgatgtggccgtgctggagctgaagagacctgtgaccttcactaagtac
atccagcccgtgtgcctgccagatgctggccatcacttccccaccagcaagaagtgcctt
atctctggctggggctacctcaaggaggatttcttggtgaaaccggagttcctgcagaaa
gcaacagtggagctcctagaccagaacctatgttccagtctctacagccatgtcctcaca
gacaggatgatgtgtgctggctacctggaggggaaggttgactcctgtcagggtgactct
ggtgggcctctggtttgccaagaaccatctggcaggttttttctggcgggaattgtgagt
tggggtattggatgtgctgaagccaggcggcctggggtttacacacgtgttaccaaactc
agagactggatcttggatgctatttctgccttccctacctccatagcccatactgttcct
ccagtgcacttcaggactaacagtaacatggtcagtgctgaagaggtcaacaccaccact
ggagcaaccccaaccaccttaccagccccagctgccagcaggccaggggctgcagcagga
ccacaagagtgtggaggacgacctgggttctctaaacccagcaagattgtgggaggaaca
gatgcttccagaggagagatcccttggcaagtcagcctgaaagaagactccagacatttc
tgtggagccaccatcattggggaccgctggctgctgtcagcagctcactgcttcaatgag
acaatgccagaagagattgaagcctatgtgggaacaacatcaataaatggaacagacgag
aatgcagtgaaagtcaatgtaacaagagtgatcccacatcccctcttcaaccccatgatt
ctggactttgatgtggctgtacttgaactggcaagacctcttgtcttcaacaaatacata
cagcctgtttgcctcccacttgccatgcagaagtttcctgttggcaagaaatgcctcatt
tctggatggggtgacctccaggaagggaatgacaccaagcccgagatcctgcagaaagcc
tctgtgggcatcatagaacagaacacctgcaacttcctctacaacttctccctcactgac
cgaatgatctgtgctggcttcatggaggggatggtagactcatgccagggagattcaggt
gggcccttggcctgtgaggtgactccaggagtgttttaccttgctggcatagtgagctgg
ggatttggttgtgcccaggctatgagacctggtgtgtactccagaattaccaaactcaca
gactggatcctggacatcatctcccagttgcccagtggtggcacaagcatcccttccagt
tcagccatccctacaacttctagcacagccatttttatccagcccagcacaatggctgca
ggtccagccagcagaaccaccctgcagacaaagatgagtacaaccatgagcgaaacttct
acagctctgagaacaactgagactgccaagcctacccaaaccccagtggtgccttgtacc
agcctcactttcaagtgttccagcaaggtgtgtattggaaaagaaaatcctgaatgtgat
ggtgttgtggactgcagcaatggcttcgatgagcgcaactgtgactgtggctcaacaaca
gctctggcctttagcaagattgtgggtggcagcagcgcggctcgaggagaatggccctgg
caagtcagtctctggcttcggcggaaggagcacaagtgtggggctgtccttattgctgac
cggtggctgctctctgcagctcactgctttgacatttacagtgaccccaaaatgtgggtg
gcctatctaggaacacccttcctgagtggcatcgatggcaaaatggagaaaatatttcgt
atctacaaacaccctttttacaacgtctacagcctagactatgatgtggcactactggag
ctgagcacacctgtcacgttcagcagcaccatcagacctatatgtctcccagacaattct
cacatcttccatgaaggggccagatgcttcatcacaggctggggttccacaaaggaagga
ggtctcatgtcaaagcatctgcaaaaagcagcagtgaacatgatcggagaccaggcctgc
aaaaagttctaccctgtccagatcagcagcaggatgctgtgtgctggtttcccacagggc
accgtcgacagctgctcagtgagtgcaagagcaggtgatgcaggtggacccctggcatgt
aaagaaccttcagggaagtggtttctagcaggaatcacaagctggggctatggctgtgcc
aggccatacttccctggtgtctataccaaagtgacagctgtccaaggctggattgtgcag
aacctcaagctctga

DBGET integrated database retrieval system