KEGG   Geospiza fortis (medium ground-finch): 102035276
Entry
102035276         CDS       T03755                                 

Gene name
DDB2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr03420  Nucleotide excision repair
gfr04115  p53 signaling pathway
gfr04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102035276 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    102035276 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102035276 (DDB2)
Ubiquitin system [BR:gfr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102035276 (DDB2)
DNA repair and recombination proteins [BR:gfr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      102035276 (DDB2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 102035276
NCBI-ProteinID: XP_005419504
UniProt: A0A6I9HEL8
LinkDB
Position
Un
AA seq 463 aa
MAPVNQPKDKKRERACQHWPEEAKSAGKRKRDYGERGNEKQEKKLFVRKTSKPSGKIGCS
GGGFVMRNKRVLSSQLERRCSIVHYVYQKMLGGSIQAQLRQRLELAFLHSLSSYCLFRRA
SPFDRRVTCLEWHPTHPSTLAVGSKGGDIILWDCEVLAKTCFIKGKGPGNSLGDIKFSPY
EAEKLYVASGDGTLSLQDLEGRAVQVISRALDCGHEHHNVCCWYCSVDVSASCHAVVTGD
NVGNVVLLSTSGEEVWKLKLHKKKVTHVEFNSRCEWMFATASVDQTVKIWDLRNIKNKTN
FLHLLPHEKPVNAAYFSPTHGAKLLSTDQHNEIRVYSSSDWTKPQHLIPHPHRQFQHLTP
IKATWHPRYDLIVVGRYPDPKFPGYTLNELRTVDVFDGNTGDMVYQLYDPNASGIISLNK
FNPMGDTLASGMGFNILIWNQEEMAAKKHEHLLKAMTNEELEP
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggctccagtgaaccagccaaaggacaagaagcgtgagagggcatgtcagcattggcca
gaagaggcaaaatcagctgggaagaggaaacgggactatggagaacgagggaatgaaaaa
caagaaaagaagttgtttgtgagaaaaacatctaaaccctcagggaaaatcggttgcagt
ggaggtgggtttgtgatgagaaacaagagagtcctttcctctcagctggagcggcgatgc
agcattgttcattatgtctaccagaaaatgctgggaggctccattcaggcacagctcagg
cagagattggagctggcttttctgcattctctttcctcatactgcctcttccgaagagca
agtccctttgacaggagagtgacatgtctggaatggcacccaacacaccccagtacgcta
gctgtcggttccaaaggtggagacatcatcctttgggactgtgaagtacttgctaaaacc
tgcttcataaaggggaaagggccaggaaattctctcggagacatcaagttcagtccttat
gaggcagagaagctttatgtggcatcaggtgatggcaccctaagtctgcaggatcttgag
ggcagagcggtgcaggtgatctctcgtgccctggactgtggccatgagcatcataatgtt
tgttgctggtactgcagtgtggacgtttctgcaagctgccatgcagtggtgacaggtgat
aatgtgggcaatgtggtcctgctcagcacttctggtgaagaggtctggaagctgaaattg
cacaagaagaaagtgactcatgtagagtttaactcccgatgtgagtggatgtttgccaca
gcatctgtggatcagacagtcaaaatctgggacctcagaaacatcaaaaacaaaacaaac
tttcttcatctgcttccacatgagaaacctgtcaatgcagcttacttcagcccaacacat
ggtgccaagcttctgagcacagaccagcacaatgaaatcagggtttactcatcttcagac
tggaccaagccacagcatctgattccacatccacataggcagtttcagcacctcacacct
attaaggcgacgtggcatcctcgctatgacctcatagtggtaggtcgctacccagacccc
aagttccccgggtacacactgaacgagctgcgcaccgtggatgtgttcgatggaaacacc
ggcgacatggtgtatcagctctatgatccaaatgcctctgggatcatctcgctcaataaa
tttaaccctatgggagacacactggcttctggcatgggctttaatattctgatctggaac
caggaggagatggcagccaagaagcatgaacatctcttgaaagccatgacaaacgaggag
cttgaaccatga

DBGET integrated database retrieval system