KEGG   Geospiza fortis (medium ground-finch): 102035332
Entry
102035332         CDS       T03755                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22-like
  KO
K10136  TP53 apoptosis effector
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102035332
SSDB
Motif
Pfam: PMP22_Claudin L_HMGIC_fpl
Other DBs
NCBI-GeneID: 102035332
NCBI-ProteinID: XP_005420192
UniProt: A0A6I9HH25
LinkDB
Position
Un
AA seq 265 aa
MEESNFLLLVPAVANTISIISVGQCWSVYPAIREEDDDLQSPRGRQGWWNPENRKVFRCG
CVFCGVCATTAERTAGGEVRGWLLPLLLGLAIIMGIIALAGRGWLESESEPYVQQASLWE
SCTRGEEDLNWNCESLMDYGWGRAAAATYLVGFVILVICFALAVIAFSIEILRFNFVRGI
GGLLFVVAAFQIIGLVIYPVKFTEDIPLTGDNMFSWAYGFGWASTVVVIGCAFFFCCLPN
WEDEVLGNIKPTYYYSSPERAPYLN
NT seq 798 nt   +upstreamnt  +downstreamnt
atggaggaaagcaactttttgcttttggtacctgcggtggctaacaccatcagtattatc
agtgttgggcaatgctggtcggtctatccagcgatcagagaggaggacgatgatctccag
tccccacgaggaaggcagggctggtggaaccccgagaaccgcaaggtttttcgctgcggt
tgcgttttttgcggtgtctgtgccacgacggcggagcggacagcgggaggagaagtgcga
gggtggctcctgcccctgctgctgggcctggccatcatcatgggcatcatcgccctggcg
ggccggggctggctggagtccgagtcggagccctacgtgcagcaagcgtctctatgggag
agctgcacgcggggcgaggaggacctcaactggaactgcgagtccctgatggactacggg
tgggggagagcagcagctgccacatacctcgttggctttgtgatcctggtcatctgtttc
gcccttgcagtcatcgcattctcgatcgagatcctccgcttcaacttcgtgcgaggaatt
ggaggcctgctctttgttgttgctgcattccagatcattggcttggtcatttacccagtg
aaattcacagaagacattccactgacaggagataacatgttcagctgggcctatggtttt
ggctgggccagcactgttgttgtaataggttgtgctttcttcttctgctgcctccccaac
tgggaagatgaagtcctgggaaacatcaagcctacctattactactcctccccagagaga
gcaccatacttaaattga

KEGG   Geospiza fortis (medium ground-finch): 102041213
Entry
102041213         CDS       T03755                                 

Definition
(RefSeq) p53 apoptosis effector related to PMP-22-like
  KO
K10136  TP53 apoptosis effector
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102041213
SSDB
Motif
Pfam: PMP22_Claudin L_HMGIC_fpl PalH PTR2
Other DBs
NCBI-GeneID: 102041213
NCBI-ProteinID: XP_005420143
LinkDB
Position
Un
AA seq 189 aa
MVKYGLDYTRCRWILPLLLGIGVIFGIIALAGWGWLESQTLPYVLQASLWQICRRGDQGG
AWSCESLMGYAWGRAAAATYLVGFLLLVICFALAIIAFAIDTLRFNFIRGIGGLLFVAAV
FSIMGLVIYPVKFSSEIEMTGVNMFSWAYGFGWTTAIMEICLGFFFCCLPNYEDQILGNV
KPTYFYSSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atggtgaagtacggcctggactacacgcgctgcagatggatcctgcccctgctcctgggc
atcggggtcatcttcggcatcatcgcgctggcgggctggggctggctggagtcgcagacc
ttgccctacgtgctgcaagcgtcgctctggcagatctgcaggaggggtgaccagggcggg
gcatggagctgcgagtccctcatgggctacgcctggggaagagctgctgctgccacatac
ctggttggctttctacttctagtcatctgttttgcactggccatcatagcttttgccatc
gacacacttcggttcaacttcatccgtgggatcggaggcttgcttttcgtggctgctgtg
ttctccatcatgggcctggtcatttacccagtaaagttctcatctgaaattgagatgaca
ggagtcaatatgttcagctgggcctatggctttggctggaccaccgccattatggaaata
tgcttgggattcttcttctgctgccttcctaactatgaagatcagatcctgggtaatgtc
aagcccacatatttttactcttccccataa

DBGET integrated database retrieval system