KEGG   Geospiza fortis (medium ground-finch): 102035379
Entry
102035379         CDS       T03755                                 

Gene name
CCNG1
Definition
(RefSeq) cyclin G1
  KO
K10145  cyclin G1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102035379 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102035379
NCBI-ProteinID: XP_005418722
LinkDB
Position
Un
AA seq 295 aa
MIDAPASGGARDPVLELPAMLEQELRAQPRAAGLRLLEAGHDNGLRMTARLRDFEVKDLL
SLTQFFGFHTETFSLAVNFLDRFLSKMKVQPKHLGCVGLSCFYLAVKASEEERNVPLATD
LIRISQYRFTVSDLMRMEKIILEKLCWKVKAITAFQFLQLYHSFIHENLSCERRKYLNFE
RLETQLKACHCRIMFSKAKPSVLALSVLALEIEEQKLLELTEPLEFLQLHSKISNRELTF
WKELVLKCLMEYSSSKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPETTS
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatcgatgccccggcgagcggcggcgctcgggacccggtgctggagctgcccgcgatg
ctggagcaggagctgcgggcccagccccgcgccgccgggctccggctgctcgaggctggc
cacgacaatgggctgcgaatgaccgcacggctgcgagacttcgaggtgaaggatctcctc
agcttgactcagttctttggcttccacaccgagacgttctctctagctgtgaatttctta
gatagattcttgtcgaaaatgaaggtacagcctaaacacttgggctgtgttggactcagc
tgcttctacttggctgtgaaggcgtcagaagaagagaggaatgtgcccttggccactgac
ttaatccgaataagccagtataggttcactgtttctgatttgatgagaatggagaaaatc
atactggagaaattgtgttggaaagtcaaagctataactgccttccaatttctacagctc
tatcattcattcattcatgagaatttaagctgtgaaaggagaaaataccttaattttgag
agacttgagacccagcttaaggcctgtcactgcagaatcatgttttctaaagctaagcct
tctgtcttggcactgtctgttttggcactagagatagaagaacaaaaactgctggagttg
acagagccattggaatttctacagttacattccaagataagcaacagagaactgaccttc
tggaaggagctggtgttgaagtgccttatggaatattcctcaagcaagtgttccaaacca
aatgtgcagaaattaaaatggattgtgtctggacgtacagctcggcagcttaaacacagc
tactacagaataacacaccttcctaccattccagagaccacctcctaa

KEGG   Geospiza fortis (medium ground-finch): 102045099
Entry
102045099         CDS       T03755                                 

Gene name
CCNG2
Definition
(RefSeq) cyclin G2
  KO
K10146  cyclin G2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102045099 (CCNG2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102045099 (CCNG2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 102045099
NCBI-ProteinID: XP_005429100
UniProt: A0A6I9HRT0
LinkDB
Position
Un
AA seq 338 aa
MSSEALWLFKQLNLHLELEGRFQPREKGLSLIEGAAENENTLCPRQRNAKVEDLWSLTNF
FGFATETFVLAVNILDRFLALMKVKPKHLSCIGVCCMQLAARVVEEECNIPSAHEIIRIS
QCKCTVSDLKRMEKIISEKLHFEFKATTALTFLHLYHTIVLCHTSERKEVLNLDKLEAQL
KACNCRLVFSKAKPSVLALCLLTLEVQTLKSVELLEILLRVQKHSKISDSDLLYWRELVS
KCLADYSSPECCKPDHKKLVWIVSRRTAQNLQNSYYSVPELPTIPEGGCFNGSESEDSCE
DMSSGEESLSSSPPSDLEGTFFFELKPKPKWQTLGCRS
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgagcagcgaggcgctgtggcttttcaagcagctgaacctccatctggagctggagggg
aggttccagccccgcgagaagggactcagcctcatcgagggtgccgccgagaatgagaac
acactgtgtccaagacaaaggaatgccaaggtggaagatctttggagtctgaccaacttc
tttggatttgcaactgaaacgtttgttttggctgtcaacattctggacagattcttggct
cttatgaaggtgaaacccaagcatttgtcttgcattggagtttgctgcatgcagctggcc
gcccgtgtggtggaggaggaatgcaatatcccatctgctcacgagatcatccggatcagc
caatgtaaatgcactgtgtccgacctgaaacggatggaaaagataatttcagaaaagttg
cactttgaatttaaagctactactgccttaaccttcttgcacttgtaccatactattgta
ctctgtcatacctcagaaaggaaagaagtgttgaatctggacaagttggaagcacaacta
aaagcttgcaactgccgtctagtgttctctaaagcaaaaccatctgtcctggccttgtgc
cttctcactctggaagttcagactctgaaatctgttgagctgttggagatccttctgcgt
gttcaaaagcattcgaagataagtgatagtgacctactttactggagggagctggtctct
aaatgcctggcagattattcttctcctgaatgctgtaagcctgatcacaaaaaactggtt
tggattgtttcgaggcgcacagcccaaaacctacaaaacagttactacagtgttcccgag
ttgccaacgatcccagagggtggatgtttcaatggaagtgagagtgaagactcctgtgaa
gacatgagcagcggggaagaaagccttagcagttctcctccgagtgatctggaaggcacc
ttcttctttgaactcaaacctaaacccaagtggcaaactctcggctgtcgctcttag

DBGET integrated database retrieval system