KEGG   Geospiza fortis (medium ground-finch): 102035924
Entry
102035924         CDS       T03755                                 

Gene name
PPM1D
Definition
(RefSeq) protein phosphatase, Mg2+/Mn2+ dependent 1D
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102035924 (PPM1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gfr01009]
    102035924 (PPM1D)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102035924 (PPM1D)
Protein phosphatases and associated proteins [BR:gfr01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    102035924 (PPM1D)
SSDB
Motif
Pfam: PP2C
Other DBs
NCBI-GeneID: 102035924
NCBI-ProteinID: XP_005424446
UniProt: A0A6I9HLI2
LinkDB
Position
Un
AA seq 443 aa
MWKKLPEWPKTMTGLPSTSGTTASVVIIRGSKMYVAHVGDSGVVLGVQDDPKDDFVRAVE
VTQDHKPELPKERERIEGLGGSVINKSGVNRVVWKRPRLSHNGPVRRSTVIDQIPFLAVA
RALGDLWSYDFYSGEFVVSPEPDTSVHTIDPQKHKYIILGSDGLWNMIPPQDAISMCQDH
EEKKYFMGEARQSCARMLVGRALGRWRQRMLRADNTSAIVICIAPLRERGRWDGDEELVL
NLAEGPSYSSPDSSSLPPSRCCTPPLKLTEDDPWPRLNSAEPIPPLLHSNMLSEKYLELP
NEIAKSNLPSSGGTPKDSAPQEEKCSKALALRLQESYSNGLSVSLSPSNSDQKGFKVSPT
GHGKAQDAERTPAGSFKRTLEESNSGPAVKKPRRGPARGLGEGAAGSPQRRSPSRLAMRR
SLRGQKKLSSSLFHPPRKALCVC
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgtggaaaaagctgccagagtggcccaagaccatgacagggctgcccagcacgtcgggg
accacggccagcgtggtgatcatccgcggctccaagatgtacgtggcccacgtgggcgac
tcaggggtggtgctgggggtccaggacgaccccaaggatgactttgtgagagctgtggag
gtgacccaggaccacaagccagagctccccaaagagagggagaggattgaaggccttggg
ggcagtgtgatcaataagtccggggtgaaccgtgtggtgtggaagaggccccggctgagc
cacaacggccccgtgcgccgcagcaccgtcatcgaccagatccccttcctggccgtggcc
agagccctgggtgatctctggagctacgacttctacagtggggagtttgtggtgtccccc
gagcccgacaccagcgtgcacaccattgacccccagaagcacaagtacatcatccttggc
agtgacgggctctggaacatgatcccccctcaggatgccatctccatgtgccaggatcac
gaggagaagaaatatttcatgggcgaggcacggcagtcctgtgcccggatgctggtgggc
cgggccctgggccgctggaggcagcggatgctgcgggcggacaacacgagcgccatcgtc
atctgcatcgcgcccctgcgcgagcgcggccgctgggacggcgacgaggagctggtgctc
aacctggccgaggggcccagctacagcagccctgacagcagcagcctgcccccctcccgc
tgctgcacgccccccctcaagctcacagaagatgacccctggccacgactgaactctgct
gagcccattcctcccctcctgcacagcaacatgctctcagaaaaatacctggagctgcca
aacgagattgccaaaagcaatttaccttcctcaggaggaaccccgaaggattcagccccg
caggaggagaagtgcagcaaagccctggcgttgaggctccaggaatcctacagcaatggt
ttgtcggtcagcctctccccttccaactcggaccaaaaaggcttcaaggtgtcccctacc
gggcacggcaaggcgcaggacgcggagaggacgcccgcgggcagctttaagcggacactg
gaggaatccaactcgggcccggcggtgaagaagccgcggcgggggccggcgcggggcctg
ggggagggcgcggccggttccccgcagcgcaggagcccctccaggctggccatgcggcgc
agcctccgcgggcagaagaagctcagcagctccctgttccacccgccccgcaaagccctg
tgcgtctgctga

DBGET integrated database retrieval system