KEGG   Geospiza fortis (medium ground-finch): 102036009
Entry
102036009         CDS       T03755                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04012  ErbB signaling pathway
gfr04068  FoxO signaling pathway
gfr04137  Mitophagy - animal
gfr04140  Autophagy - animal
gfr04141  Protein processing in endoplasmic reticulum
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr04310  Wnt signaling pathway
gfr04510  Focal adhesion
gfr04530  Tight junction
gfr04620  Toll-like receptor signaling pathway
gfr04621  NOD-like receptor signaling pathway
gfr04622  RIG-I-like receptor signaling pathway
gfr04625  C-type lectin receptor signaling pathway
gfr04910  Insulin signaling pathway
gfr04912  GnRH signaling pathway
gfr04914  Progesterone-mediated oocyte maturation
gfr04920  Adipocytokine signaling pathway
gfr05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102036009 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102036009 (MAPK8)
   04012 ErbB signaling pathway
    102036009 (MAPK8)
   04310 Wnt signaling pathway
    102036009 (MAPK8)
   04068 FoxO signaling pathway
    102036009 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102036009 (MAPK8)
   04137 Mitophagy - animal
    102036009 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    102036009 (MAPK8)
   04217 Necroptosis
    102036009 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102036009 (MAPK8)
   04530 Tight junction
    102036009 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102036009 (MAPK8)
   04621 NOD-like receptor signaling pathway
    102036009 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    102036009 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    102036009 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102036009 (MAPK8)
   04920 Adipocytokine signaling pathway
    102036009 (MAPK8)
   04912 GnRH signaling pathway
    102036009 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    102036009 (MAPK8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102036009 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102036009 (MAPK8)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102036009 (MAPK8)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102036009 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH DUF530 FTA2
Other DBs
NCBI-GeneID: 102036009
NCBI-ProteinID: XP_005416537
UniProt: A0A6I9HC07
LinkDB
Position
Un
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPAPLGAAMINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLETSA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcaggagcaagcgtgacaacaatttttacagcgttgaaattggagattcaactttc
accgtattgaaacggtatcagaatttgaaaccaataggatcaggagcacaagggatagta
tgtgcagcttatgatgccatccttgagcggaacgttgcaatcaagaagttaagccgaccg
tttcagaaccaaacccacgctaaaagagcctacagagagcttgttcttatgaagtgcgtt
aatcacaaaaatataattggcctactgaatgtgttcacgccacaaaaatccctggaagaa
tttcaagatgtctacatagtgatggagctcatggatgcaaatctctgccaagtgattcag
atggagctggaccatgaacgaatgtcctatcttctttatcaaatgctgtgtggtatcaaa
catcttcattcagctgggattattcatagggatttaaagcccagtaatatagtagtaaag
tcagactgcactttgaagattcttgactttggactggccagaactgcaggaactagtttt
atgatgacgccttatgtagtgactcgttactacagagcaccagaggtcatcctagggatg
ggatacaaagaaaacgtggatttatggtctgtggggtgcattatgggcgaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcaatggaataaagttatagagcag
ctaggaacaccgtgccctgaatttatgaagaaactacagcctacagtccgaacttacgtg
gagaacagacctaaatatgctggatatagttttgaaaaactctttccagatgtccttttc
ccagctgactctgaacacaataaacttaaagcaagtcaagcaagagatttgttatcaaaa
atgctggttatagatgcttctaaaagaatctctgtggatgaagccctgcagcacccatac
atcaatgtttggtatgatccatcagaagcagaagctcctccaccaaagataccagataag
cagttagatgagagggagcacacgatagaagagtggaaagagttgatatacaaggaagtc
atggacctggaggaaagaaccaagaacggggttatacgtggccaaccagcccctttaggt
gcagcaatgatcaatggctctcaacacccatcttcatcgtcatctgtcaacgatgtgtct
tcaatgtcaacagatccaacattggcctctgatacagacagcagtctagaaacctcagct
ggacctctgggttgctgtagatga

KEGG   Geospiza fortis (medium ground-finch): 102043222
Entry
102043222         CDS       T03755                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04012  ErbB signaling pathway
gfr04068  FoxO signaling pathway
gfr04137  Mitophagy - animal
gfr04140  Autophagy - animal
gfr04141  Protein processing in endoplasmic reticulum
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr04310  Wnt signaling pathway
gfr04510  Focal adhesion
gfr04530  Tight junction
gfr04620  Toll-like receptor signaling pathway
gfr04621  NOD-like receptor signaling pathway
gfr04622  RIG-I-like receptor signaling pathway
gfr04625  C-type lectin receptor signaling pathway
gfr04910  Insulin signaling pathway
gfr04912  GnRH signaling pathway
gfr04914  Progesterone-mediated oocyte maturation
gfr04920  Adipocytokine signaling pathway
gfr05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102043222 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102043222 (MAPK9)
   04012 ErbB signaling pathway
    102043222 (MAPK9)
   04310 Wnt signaling pathway
    102043222 (MAPK9)
   04068 FoxO signaling pathway
    102043222 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102043222 (MAPK9)
   04137 Mitophagy - animal
    102043222 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    102043222 (MAPK9)
   04217 Necroptosis
    102043222 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102043222 (MAPK9)
   04530 Tight junction
    102043222 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102043222 (MAPK9)
   04621 NOD-like receptor signaling pathway
    102043222 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    102043222 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    102043222 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102043222 (MAPK9)
   04920 Adipocytokine signaling pathway
    102043222 (MAPK9)
   04912 GnRH signaling pathway
    102043222 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    102043222 (MAPK9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102043222 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102043222 (MAPK9)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102043222 (MAPK9)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102043222 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102043222
NCBI-ProteinID: XP_005418771
UniProt: A0A6I9HDQ8
LinkDB
Position
Un
AA seq 424 aa
MTDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKLKTSQARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVNSNTSPSQSSSINDISSMSTEQTLASDTDSSLDALTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgactgacagtaaatgtgatagtcaattttacagtgttcaagttgcagattcaacattc
actgtgctaaaacgttaccagcaactgaagcccataggatcaggggcacagggcattgtt
tgtgctgcatttgatacagtgcttggaatcaatgttgctgtgaagaagctgagtcgtcct
tttcagaaccaaacccacgccaagagggcttacagagagctcgttcttttaaagtgcgtc
aatcacaaaaatattattagtttattaaatgtatttacaccacagaagtcactagaagaa
tttcaggatgtatatttggttatggagctgatggatgcaaatttgtgccaggttattcat
atggaattggatcatgaaagaatgtcttatcttctttaccaaatgctatgtgggatcaag
catctccactcagctggtatcatccacagagatttgaaacccagcaacatagtagtaaaa
tcagattgcacactaaaaatccttgattttggactggcaagaacagcatgtactaacttc
atgatgactccatatgtggtaacacggtattacagagctccagaggttatcctgggaatg
ggatacaaagagaatgtggatatctggtctgttgggtgcattatggcagaaatggtcctc
cataaagtcctgttcccaggaagagattatattgatcaatggaataaagttattgaacaa
ttaggaacaccatcagcagacttcatgaagaaactgcagcctacagtgaggaattatgta
gaaaacaggccaaaatatcctggtattaagtttgaggagctcttcccagactggatattt
ccatcagaatctgatcgcgacaagttaaaaaccagccaagctagagatttattgtcaaaa
atgcttgtagtagatccagacaagagaatttctgtagatgaagccttacgtcatccttat
attactgtctggtatgatccagctgaagcagaagctcctccacctcaaatctatgatgca
caattggaagaaagagagcatgcaattgaggaatggaaagaattaatatacaaagaagtt
atggattgggaagaaaggagcaagaatggtgtggtaaaagatcagccctcagatgcagca
gtgaatagcaacaccagtccttcccagtcatcatctatcaatgacatttcatccatgtca
acagagcagacattggcctcagacacagacagcagcctggatgccttgacaggacccctc
gaaggatgtcgatga

KEGG   Geospiza fortis (medium ground-finch): 102043776
Entry
102043776         CDS       T03755                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04012  ErbB signaling pathway
gfr04068  FoxO signaling pathway
gfr04137  Mitophagy - animal
gfr04140  Autophagy - animal
gfr04141  Protein processing in endoplasmic reticulum
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr04310  Wnt signaling pathway
gfr04510  Focal adhesion
gfr04530  Tight junction
gfr04620  Toll-like receptor signaling pathway
gfr04621  NOD-like receptor signaling pathway
gfr04622  RIG-I-like receptor signaling pathway
gfr04625  C-type lectin receptor signaling pathway
gfr04910  Insulin signaling pathway
gfr04912  GnRH signaling pathway
gfr04914  Progesterone-mediated oocyte maturation
gfr04920  Adipocytokine signaling pathway
gfr05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102043776 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102043776 (MAPK10)
   04012 ErbB signaling pathway
    102043776 (MAPK10)
   04310 Wnt signaling pathway
    102043776 (MAPK10)
   04068 FoxO signaling pathway
    102043776 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102043776 (MAPK10)
   04137 Mitophagy - animal
    102043776 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    102043776 (MAPK10)
   04217 Necroptosis
    102043776 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102043776 (MAPK10)
   04530 Tight junction
    102043776 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102043776 (MAPK10)
   04621 NOD-like receptor signaling pathway
    102043776 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    102043776 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    102043776 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102043776 (MAPK10)
   04920 Adipocytokine signaling pathway
    102043776 (MAPK10)
   04912 GnRH signaling pathway
    102043776 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    102043776 (MAPK10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102043776 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102043776 (MAPK10)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102043776 (MAPK10)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102043776 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kinase-like APH Kdo FTA2
Other DBs
NCBI-GeneID: 102043776
NCBI-ProteinID: XP_005418271
LinkDB
Position
Un
AA seq 457 aa
MSRHFLYYFGEPTLDVKIAFCQGFGKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMIISLL
NVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIH
RDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDMW
SVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGL
TFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYINVWYDPAE
VEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESL
PPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgagccgccatttcttgtattattttggtgaacctactctggatgtgaagattgccttt
tgtcagggatttgggaaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagcgtggaagtaggtgactcgaccttcacagtc
ctcaaacgctaccagaacttgaaacctattggctctggggctcagggaatagtttgtgct
gcatatgatgccgtccttgacagaaatgtggccattaagaagctcagcagaccatttcag
aaccaaactcatgccaagagagcttacagggagctggtcctcatgattataagtttatta
aatgtcttcacaccacagaaatctctggaggagttccaggatgtctacctggtaatggaa
ttaatggatgccaacctgtgccaggtcattcagatggagctggaccatgagcgaatgtct
taccttctgtaccaaatgctctgtggaatcaagcatcttcactctgcagggattattcac
agggatttaaaaccaagtaacattgtagtaaaatctgactgcacgttgaagattctggat
tttggactggccaggactgcaggcactagcttcatgatgaccccctatgtggtgacacgt
tactacagagcaccggaggtcatcctgggaatgggctacaaggagaacgttgacatgtgg
tcagtagggtgcatcatgggagaaatgattaaaggtgctgtgttgtttcctggcactgat
catattgatcagtggaataaagttattgagcagctgggaacaccgtgtccagaattcatg
aagaagctgcagccaacagtacggaactacgtcgagaacagacccaagtatgctggcctc
actttccccaaactttttccagactctctcttcccagcagactcagaacacaacaaactc
aaagccagccaagccagggacctcttatcaaagatgctggtcattgacccggccaagagg
atatcagtagatgaagccttacagcatccatacattaatgtctggtacgacccagcagag
gtggaggcgcctcctcctcagatatatgataaacagctggatgaaagggaacatacaatc
gaggaatggaaagaactcatctacaaagaagtaatgaattctgaagaaaagactaaaaat
ggcgtagtaaaaggacagccttctccttcaggtgcagcagtgaacagcagtgagagcctc
cctccatcctcatctgtcaacgacatctcatccatgtccacggatcaaaccctggcgtct
gacacggacagcagcctggaagcttctgcgggacccctcggttgttgcaggtga

DBGET integrated database retrieval system