KEGG   Geospiza fortis (medium ground-finch): 102036392
Entry
102036392         CDS       T03755                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04217  Necroptosis
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102036392 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102036392 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102036392 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gfr03000]
    102036392 (STAT3)
Transcription factors [BR:gfr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102036392 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 102036392
NCBI-ProteinID: XP_005429641
UniProt: A0A6I9HTI2
LinkDB
Position
Un
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGSSSEGAESNAGGQFESLTFDMELTPECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcgctacctggagcagctccaccag
ctctacagcgacagcttccccatggagctccggcagttcctggccccctggattgaaagc
caggactgggcctatgctgccagcaaggagtcgcacgccacgctggtgttccacaacctg
ctgggggagattgaccagcagtacagccgcttcctgcaggagtccaatgtcctctaccag
cacaacctgcgccgcatcaagcagttcctgcagagcagatacctggagaagccaatggaa
atcgcccgcatcgtggctcgctgcctctgggaagagtcccggctcctccagacagctgct
actgcagcccagcaagggggacaggcaacacatcccacagcagctgtggtgacagagaag
cagcagatgctggagcagcacctgcaggatgtcaggaagagagtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggacctgaacggcaacaaccagtcagtgacccggcagaagatg
cagcagctggagcaaatgctgacagcactggaccagatgcgcaggggcatagtgagcgag
ctggctgggctgctgtctgccatggaatatgtgcagaagatgctggcagatgaggaactg
gcagactggaagaggagacagcagattgcctgcattggtggcccacccaatatctgcctg
gacaggcttgagaactggataacctccctcgctgaatcacagctacagacccggcagcag
atcaagaagttggaagaactgcagcaaaaagtgtcctacaagggtgacccaatcgtccag
caccggcccatgctggaggagcgcattgtggagctgttcaggaacctgatgaaaagtgct
tttgtggtggagaggcagccctgcatgcccatgcaccctgaccggcccctggtcatcaag
acaggtgtgcagttcaccaccaaagtcaggttgttggtcaagttcccagagctgaactat
cagctgaaaatcaaagtctgcattgacaaggactctggggacgttgctgcacttcgaggg
tcccgcaagtttaacatcctggggaccaacaccaaggtgatgaacatggaggagtcaaac
aatggcagcctctcagcagagttcaaacacctgaccctgagggagcagcgctgtgggaat
ggaggccgagccaactgtgatgcctcgctgatagtcactgaggagctgcacctcatcact
tttgagacagaggtgtatcaccaggggctgaagatcgacctggagacccattcgctgcct
gtggtggtcatctccaacatctgccagatgcccaatgcctgggcatccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccccccattgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccaccaagcgcgggctc
agcatcgagcagctgaccacgctggcagagaaactgctgggaccaggtgtgaattactct
ggctgtcagatcacttgggccaagttctgcaaggagaacatggctggcaaaggcttctct
ttctgggtctggctggataacatcattgacttggtgaagaagtacatcctggcactgtgg
aacgaagggtacatcatgggcttcatcagcaaggagcgggagcgagccatcctgagcacc
aagcccccagggacctttctgctgcgcttcagtgagagcagcaaggagggtggcatcacc
ttcacctgggtggagaaggacatcagtgggaagacgcagatccagtcggtggagccttac
accaagcagcagctcaacaacatgtcctttgctgagatcatcatgggctacaagatcatg
gatgccaccaacatcctggtgtcccctctggtgtacctgtacccagatatccccaaggag
gaggcatttgggaagtactgccgctctgagagccaggaacactcggaagccacggactca
ggtagtgctgctccatacctgaagaccaagttcatctgtgtcacccccacctccttcagc
aacaccatcgacctgcccatgtccccgcgcacgctggactcgctcatgcagttcggcagc
agcagcgagggcgcggagagcaacgcgggcgggcagtttgagtcgctgaccttcgacatg
gagctgaccccagagtgcgcgtcctcgcccatgtga

DBGET integrated database retrieval system