KEGG   Geospiza fortis (medium ground-finch): 102036429
Entry
102036429         CDS       T03755                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr05164  Influenza A
gfr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102036429 (BID)
   04217 Necroptosis
    102036429 (BID)
   04115 p53 signaling pathway
    102036429 (BID)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102036429 (BID)
   05168 Herpes simplex virus 1 infection
    102036429 (BID)
SSDB
Motif
Pfam: BID Bcl-2 TAFH CRM1_C HBD DUF3349
Other DBs
NCBI-GeneID: 102036429
NCBI-ProteinID: XP_014164244
LinkDB
Position
Un
AA seq 181 aa
MFQINGPLQMEHALLFSFLEVSSDCKFKDQLHSLQSQQIMLYQGSDDDELQTDGNRSGHF
RNGLAPTNDEVIRIIAAQLAEIGDQLDKEIQERVVNGLVQHFMNENLSNEEITRHMSRVV
RELIQAIPSDMEQEKAMLVLAMVLTKKIVNTVPFLLRRVFDTTVNYMNRQFHNYIVDMLG
E
NT seq 546 nt   +upstreamnt  +downstreamnt
atgtttcagatcaatggacctcttcagatggagcatgcattgctgttcagcttcctggag
gtatcctctgactgtaagttcaaagaccagctgcattccctgcaaagccagcagatcatg
ttgtaccaagggagcgatgatgacgagctgcagaccgatggcaatcgcagtggccacttc
cggaatgggttggctccaacaaatgacgaggttatccggatcattgctgctcagctcgcc
gagattggagaccagttggataaagaaatccaagaaagagtagtaaatggcctagtgcag
cattttatgaatgagaatctgtctaatgaggagataacccggcacatgtcccgggtagtg
agagagctcatacaagccatcccctcagacatggaacaggagaaggccatgttggtgcta
gcaatggtgttgactaagaaaattgtgaatacagtgcctttccttctgcgccgtgtcttc
gacaccactgtgaactacatgaaccggcagttccacaactacattgttgatatgctgggt
gagtga

DBGET integrated database retrieval system