KEGG   Geospiza fortis (medium ground-finch): 102036629
Entry
102036629         CDS       T03755                                 

Gene name
ZMAT3
Definition
(RefSeq) zinc finger matrin-type 3
  KO
K10137  zinc finger, matrin type 3
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102036629 (ZMAT3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 102036629
NCBI-ProteinID: XP_005419081
LinkDB
Position
Un
AA seq 290 aa
MILLQQAGLLPHPEKPSSLPMSVATRPRASSPLSPPKSLGLGPSFHHAQEEELAKVVEQD
PMLEELCKPLSCKLCNVTLNSAQQAQAHYQGKNHSKKLRNYYAANSCPAPARMSNSVEPA
PPQVVSLPTQMGSSKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QNNSFSDASELGKRRARKEGNEYKMMQNRRNTYAVQNNTAGPYFNPRSRQRIPRDLAMCV
TPSGQFYCSMCNAGASEELEFRQHLESKQHKSKVSEQRYRNEMENLGYVQ
NT seq 873 nt   +upstreamnt  +downstreamnt
atgattcttctacagcaagcaggacttcttcctcatcctgagaagccttcatcccttcct
atgtcagtggctaccaggccaagagccagctcaccactgtccccaccaaagtctctcgga
ctggggccttcctttcatcacgcacaagaagaggaacttgccaaggtggtggagcaggac
cctatgctggaggaactatgtaagcccctgtcctgtaagctttgcaatgtcactctgaac
tcggcccagcaagcccaggctcattaccaggggaaaaaccacagtaagaagctccggaat
tactatgctgccaacagctgtccggcccctgccaggatgagtaattctgttgagcctgcc
ccacctcaggttgtctcccttccaactcagatgggatccagtaagccaggtggccgagtg
atcttggctacagagaatgattactgcaagctttgtgatgcctcatttagctccccggct
gtggcacaggctcactaccaagggaaaaatcacgccaagcggctgcgtcttgcagaggca
cagaataactcgttctcggatgcctcggaactaggcaaacgaagggcaaggaaagaaggg
aatgaatataagatgatgcagaacagaagaaacacgtatgcggttcagaacaacacagct
ggtccctacttcaacccgcgctcgcggcagaggatcccccgtgacctggccatgtgcgtg
acgcccagcgggcagttctactgctccatgtgcaacgctggggccagcgaggagctggag
ttcaggcagcacctggagagcaagcagcacaagagcaaagtgtctgagcagcgctacagg
aacgagatggagaaccttggctacgtccagtga

DBGET integrated database retrieval system