KEGG   Geospiza fortis (medium ground-finch): 102036717
Entry
102036717         CDS       T03755                                 

Gene name
SERPINB5
Definition
(RefSeq) serpin family B member 5
  KO
K10139  serpin B5
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102036717 (SERPINB5)
Peptidases and inhibitors [BR:gfr01002]
 Peptidase inhibitors
  Family I4: serpin family
   102036717 (SERPINB5)
SSDB
Motif
Pfam: Serpin Toprim_Crpt TetR_C_37
Other DBs
NCBI-GeneID: 102036717
NCBI-ProteinID: XP_005425885
UniProt: A0A6I9HPQ9
LinkDB
Position
Un
AA seq 377 aa
MTMDALQLANTAFAVDMFKKLCEKDKTANVIFSPLCTSTSLALAYKATKGDTAEQMKQVL
HLQDVKDVSFGFQTITSDVSKLSSFFALKMVKRLFVDKSLNPTTDFVNSTKRPFPSELEL
VEFKEKTEETREKINKSLSELTDGKMENVLNEDSVSDQTQILLVNAAYFVTNWMKKFPEA
EIKECPFKVNKTETKPVQMMNLEATFCLGYVKDLNVAILELPCLNKHISMLILLPKEIED
ETTGLEKLEKALTPETLLQWTNPSMMANTKVNVFLPKFNVEGDYDLKPLLESLGMTNIFD
ESASDFSEMCETKGVVVSKIIHKVSLEVNEQGGDSREVPGYRILQHKDEFKADHPFIFLF
RHNKTRNVILSGRFCSP
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgacaatggatgctctgcaactagcaaacactgcctttgcagttgatatgttcaaaaag
ctatgtgagaaggacaaaacagccaacgttattttttccccactgtgcacctcaacgtct
ctggctctggcatacaaagccacgaaaggtgacactgcagagcagatgaaacaggtgctc
catttacaagatgtcaaagatgtttcttttgggtttcaaacaataacttcagatgtttcc
aaactcagctctttctttgcactgaaaatggttaaacgcctctttgtagacaagtctctc
aatcctaccacagactttgtcaactccacaaagagaccttttccatctgaactggaatta
gtggagttcaaagaaaaaactgaggaaacccgagaaaagatcaacaaatccctttcagag
ctgactgatggaaaaatggagaatgttttgaatgaggacagtgtaagtgaccagactcag
attcttctagttaatgcagcttattttgttacaaactggatgaagaagttcccagaggca
gagatcaaagaatgtccttttaaagtcaacaagactgaaactaagccagtgcagatgatg
aatctggaagctactttttgcctgggctatgtaaaagatttaaatgttgccatccttgag
ctcccatgccttaacaaacatataagcatgctcattctcctgcccaaagagattgaagat
gagaccactggcttggagaagctggaaaaggcactgacgcctgagacattattacagtgg
acaaatcccagcatgatggccaacaccaaagtgaatgtatttcttccaaagtttaatgtg
gaaggtgactatgacctgaagccacttctggaaagcctgggaatgacaaatatcttcgac
gaaagtgcatcagatttttctgagatgtgtgagacaaaaggtgtagttgtgtcaaagatc
atccataaagtctccttggaagtcaatgaacagggtggtgactcccgagaggtacctgga
tatcggattctgcaacacaaagatgaatttaaagctgatcatccatttatctttttgttt
agacacaacaaaactcgcaacgtgattctttcaggccgattctgttctccttaa

DBGET integrated database retrieval system