KEGG   Geospiza fortis (medium ground-finch): 102037015Help
Entry
102037015         CDS       T03755                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00052  Galactose metabolism
gfr00500  Starch and sucrose metabolism
gfr01100  Metabolic pathways
gfr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102037015 (GAA)
   00500 Starch and sucrose metabolism
    102037015 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102037015 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gfr04147]
    102037015 (GAA)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102037015 (GAA)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102037015 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 102037015
NCBI-ProteinID: XP_005430324
LinkDB All DBs
Position
Un
AA seq 700 aa AA seqDB search
MFISDPFGLVVCRQRGGTVLLNTTVAPLFFTDQFLQISTSLPSHFISGLGEHLTPLFLDT
AWTRVTLWNRDMAPAPHVNLYGSHPFYLVMEDDGSAHGVFLLNSNAMDVLLQPSPALTWR
TTGGILDFYIFLGPDPKSVVRQYLDVVGFPFMPPYWGLGFHLCRWGYSSTDITRQVVANM
TAARFPLDVQWNDLDYADAKRDFTFNKKSFRDYPEMVRDFHSRGLRYIMIVDAGISSSGP
PGTYKPFDEGLRRGVFIRNATGQPLIGKVWPGPTAFPDFTNPETHEWWHDMVKDFHEQVP
FDGMWLDMNEPSNFVEGSQDGCPNNNLEHPPYVPGVFGGRLQAGTICASSQQYLSSHYNL
HSLYGLTEAIASHNALLRVRGKRPFIISRSTFAGHGRYAGHWTGDVGSDWQQLYYSIPEV
LLFNLFGVPLVGADICGFLGDTSEELCVRWTQLGAFYPFMRNHNDHGTRLLPFLYTLFHR
AHSAGQTVARPLFLEFPTDPNTWAVDRQLLWGWGLLITPVLEAGQTKVSGYFPAGMWCSL
TGDSTIHSKGQWILLPAPLDTINVHVRAGHILPLQEPAFSTAQSRGKGMALVVALTPDGF
ARGELFWDDGESWETFERGDYTELLFLASNDAVLSQLLRASAHLDGVLLEAVTVLGVTSP
PRRVLANGAIVSDFSYRSDTQVLRVPVALPMWEQFVISWS
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtttatttcagaccccttcggcctcgtcgtgtgccggcagcgcggcgggacagtcctg
ctgaacaccacggtcgcacccctcttcttcacagaccagttcctgcagatctccacctcc
ctgccctcccatttcatttcggggctgggggagcacctgaccccgctgttccttgacaca
gcatggaccagggtcaccctctggaatcgggacatggcacctgcgccccacgtcaacctc
tacggctcccaccctttctacctggtcatggaggacgatggttcagcccacggcgtcttt
ctgctgaacagcaatgccatggacgtgctcctgcagcccagcccagccctgacctggcgc
acgacaggagggatcctggacttctacatcttcctgggccccgaccccaagagtgtggtg
cggcagtacctggatgtggttgggttccccttcatgcccccgtactggggcctgggcttc
cacctgtgccgctggggctactcctccacggacatcacccggcaggtggtggccaacatg
acagcagctcgcttccccctggatgtgcagtggaacgacctggattacgcagatgccaag
agggatttcaccttcaacaagaaaagcttcagggactacccggagatggtgcgggacttc
cacagccgtgggctgaggtacatcatgattgtggacgctggcatcagcagctcggggccc
cctggcacctacaaacccttcgacgagggcctgaggcgaggggtgttcatcagaaatgcc
acggggcagcccctgatcgggaaggtctggccaggccccacggcgttcccagacttcacc
aacccagagactcacgagtggtggcacgacatggtgaaggacttccacgaacaagtgccc
ttcgatggcatgtggcttgacatgaacgagccgtccaacttcgtggagggctcccaggac
ggctgccccaacaacaacctggagcatcccccgtacgtgccaggtgtgttcgggggccgc
ctgcaggccgggaccatctgtgcctccagccagcagtacctgtcctctcactacaacctg
cacagcctgtacgggctgaccgaggccatcgcctcccacaatgctctgctgagggtgcgg
ggcaagcgtcccttcatcatctctcgctccaccttcgccgggcacgggcgctacgccggg
cactggacaggggacgtgggcagcgactggcagcagctctactactccataccagaggtg
ctgctcttcaacctcttcggggtgccactggtgggtgccgacatctgcggcttcctgggc
gacaccagcgaggagctgtgtgtgcgctggacccagctgggcgccttctaccccttcatg
aggaaccacaacgaccacggcacccggctgctgcccttcctctacacgctgttccaccgg
gcgcacagcgccgggcagaccgtggcacggcccctgttcctcgagttccccacagacccc
aacacctgggctgtggaccgccagctcctgtggggctgggggctgctcatcacccccgtg
ctggaggcaggacagaccaaagtcagcggctacttcccagcagggatgtggtgcagcctc
acaggggactccaccatccacagcaaagggcagtggatcctcctgccagcgcccctggac
accatcaacgtccacgtccgtgcagggcacatcctgcccctgcaggaacctgccttcagc
actgcccagtcccgtgggaagggcatggccctggtggtggcactgaccccggacggcttc
gccaggggagagctgttctgggacgatggggagagctgggagacctttgagaggggcgac
tacaccgagctgctcttcctggcctccaacgacgccgtgctcagccagctgctgcgggcc
agtgcccacctggacggggtcctgctggaggctgtcactgtcctgggggtcaccagccct
ccccggcgagtcctggccaacggggccatcgtcagtgacttctcctaccgcagtgacacc
caggtgctgagagtccctgtggcgctgcccatgtgggagcagtttgtgatctcctggtcc
tga

DBGET integrated database retrieval system