KEGG   Geospiza fortis (medium ground-finch): 102037223Help
Entry
102037223         CDS       T03755                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gfr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    102037223 (LIG3)
Enzymes [BR:gfr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102037223 (LIG3)
DNA repair and recombination proteins [BR:gfr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     102037223 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 102037223
NCBI-ProteinID: XP_005425458
LinkDB All DBs
Position
Un
AA seq 903 aa AA seqDB search
MAEQRYCVDYAKRGTAGCKKCKEKIVKGMVRIGKIVPNPFTESGGDMKEWYHVKCIFEKL
DKARATTKKIEDITDLEGWEELQDEEKETINKYISEANSKTGGTPKKKVIVQAKLTATGQ
LTTKDPPKKFSGFSAKPKNSEDSPAKCAQKPSLSAARCDPQHKDCLLREFRKLCAMVAEK
PSYNVKTQIIQDFLRKGSAGDGFHGDVYLTIKMLLPGVIKIVYNLNDKQIVKLFXXXXSR
IFNCNQEEMIRDLEQGDVSETIRIFFEQSKTCPPAAKSLLTIQEVDEFLMQLSKLTKEDD
QQSVLQQISRRCTGNDLKCIIRLIKHDLKMNAGAKHVLDALDPNAYEAFKASRNLQDVVE
RVLQNQQEAEKVPGLKKTLSVQASLMTPVQPMLAEACKSIEYAMKKCPNGMYAEIKYDGE
RVQVHKNGDHFSYFXXXXXSLQPVLPHKVAHFKDFIPQAFPGGQSMILDSEVLLIDNKTG
KPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDISLMDRPLCERRKFLHDNMVEIPNXDP
VLRDETCHKSFRSGRHDHRVIREGLEGLVLKDIKGNYEPGKRHWLKVKKDYLNEGAMADT
ADLVVLGAFYGQGSKGGMMSIFLMGCYDPKSEKWCTVTKCSGGHDDATLARLQTELDMVK
ISKDPSKIPRWLKINKIYYPDFIVPDPKKAPVWEITGAEFSKAEAHTADGISIRFPRCTR
IRDDKDWQTATNLQQLKELYQLSKEKADFSVTAGEEDESTAGSSGENDGNSRSSTPHSSI
KSPPSKSPAKAQKAEDSKGIVGSPQKSEERRGEKRKASEMEDNGKKPLLDIFTGVKLYLA
PSVPDFARIRRYFIAFDGDLVEEFDTASATHVLGDIDDNPGAQRVTPRWIWECIRKRRLV
APC
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcagcggtactgcgtggactatgccaagcggggcaccgcgggctgcaagaag
tgcaaggagaagatcgtgaaggggatggtgcgcattgggaagattgttcccaatcctttc
accgagtctggaggggacatgaaggagtggtaccatgtcaagtgcatctttgagaagctg
gacaaggcccgggccaccactaagaaaattgaagacatcacagacttggaggggtgggaa
gagctgcaggatgaggagaaggaaacaatcaacaagtacatctcagaagccaattccaag
actggaggtaccccaaagaaaaaggtgatagtgcaggcaaaactcactgccacaggacag
ctgaccacaaaagatccaccgaagaaattctctggattctctgccaagccaaagaattca
gaagattctcctgcaaagtgtgcccagaagccgagcctgtctgcagcccggtgtgacccc
cagcacaaggactgcctgctgcgcgagttccgcaagctctgcgccatggtggctgagaaa
ccaagctacaacgtcaaaacccagatcatccaggacttcctcaggaagggatctgcagga
gatggttttcatggtgatgtatacctgaccattaagatgctgttaccaggtgtcattaaa
atagtttacaacttgaatgataagcagattgtaaagctgttcannnnnnnnnntagcagg
atttttaactgcaaccaggaagaaatgatccgggacctggagcagggagatgtttctgag
accatccggattttcttcgagcagagcaagacctgtcctccagcagccaagagcctcctg
accatccaggaggtggatgagttcctcatgcagctgtccaagctcaccaaggaggatgac
cagcagagtgtcctgcagcagatcagtcgcaggtgtacaggcaatgacctgaagtgcatc
atcaggctaattaagcatgacttgaaaatgaatgctggagcaaagcatgtgttggacgct
ctggatcccaacgcctacgaggcgttcaaggcctcgaggaacctgcaggacgtggtggag
agggtgctgcagaaccagcaggaggcagagaaggtgccagggctgaagaagaccctgagt
gtgcaggcctcactcatgaccccagtgcagcccatgctggctgaggcctgcaagtccatc
gagtacgccatgaagaagtgtcccaatgggatgtacgccgagatcaagtacgacggcgag
cgcgtgcaggtgcacaagaacggggatcacttcagctacttcagnnnnnnnnnnnggagc
ctccagcctgtgctcccccacaaagtagcccatttcaaggatttcatcccccaggctttc
cctggtgggcaaagtatgattctggattcagaagttctcctgattgacaataaaactggc
aagccacttccttttgggactcttggtgtgcacaagaaagctgctttccaggatgccaac
gtttgcctgtttgtgtttgactgcatctacttcaatgacatcagcctgatggacaggccc
ctctgtgaacggcgcaagttcctccacgacaacatggtggagatccccaacnaggatcct
gttctcagagatgaaacatgtcacaaaagcttcagatctggcagacatgatcaccgggtc
atccgggaggggctggaagggctggtgctgaaggacataaagggtaattatgagccaggg
aaacgccactggctgaaggtgaagaaggattatctcaacgagggggcaatggctgacact
gctgacctggtggtgctgggggctttctatggacaaggcagtaaaggtgggatgatgtcc
atcttcctcatgggctgctacgaccccaagagtgagaagtggtgcacggtgaccaagtgc
tctggtggccacgatgacgccaccctggcacgtctgcagacagagctggacatggtgaag
atcagcaaggatcctagtaaaattccaaggtggctaaaaattaacaaaatctactaccca
gacttcattgtcccagatccaaagaaagccccggtgtgggagatcacgggggccgagttc
tccaaggccgaggcgcacacggctgacgggatctccatccgcttcccgcgctgcacccgc
atccgcgatgacaaggactggcagacagccaccaacctgcagcagctcaaggagctgtac
cagctctccaaggagaaggctgatttcagtgttacagctggggaggaagatgagtccaca
gctggcagcagtggagagaatgatgggaattccaggtcttccacacctcacagcagtatt
aagagtcccccaagcaagtcacctgcaaaagcccagaaggcagaagacagcaaaggaatc
gttggatcccctcaaaaatccgaggagagacgaggggagaaaagaaaagcgtctgagatg
gaggacaatggaaaaaagcccctgctggacattttcacgggggtgaagctgtacctggcg
ccctcggtgccggactttgcgcggatccgccgctacttcatcgccttcgacggggacctg
gtggaggagttcgacacggcctcggccacccacgtgcttggggacattgatgacaacccc
ggggcgcagcgtgtgactcccaggtggatctgggagtgcatccggaagcgcaggctggtg
gcgccgtgctag

DBGET integrated database retrieval system