KEGG   Geospiza fortis (medium ground-finch): 102037225Help
Entry
102037225         CDS       T03755                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00040  Pentose and glucuronate interconversions
gfr00051  Fructose and mannose metabolism
gfr01100  Metabolic pathways
Module
gfr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102037225 (SORD)
   00051 Fructose and mannose metabolism
    102037225 (SORD)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     102037225 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C DUF281 ADH_zinc_N_2 DUF2249
Motif
Other DBs
NCBI-GeneID: 102037225
NCBI-ProteinID: XP_014164475
LinkDB All DBs
Position
Un
AA seq 388 aa AA seqDB search
MDSSAAKPGGGIRDLSTGNSNSRSPSAIPARTVRETGAGGGWVVVAPLGCQSQENRPIPE
PGPNEVLLRMHSVGICGSDVHYWQHGRIGDFVVKDPMVLGHEASGTVVKVGSGVTHLKPG
DRVAIEPGVPREMDEFCKSGRYNLSPTIFFCATPPDDGNLCRYYKHSASYCYKLPDNVTF
EEGALIEPLSVGIHACKRAGVTLGSKVFVSGSGPIGLVNVIVAKMMGAAAVVVTDLSASR
LQKAKEVGADFTIQVKNETPQEVASKVESVLGCMPEITVECTGVQACIQAGIYATRSGGT
LVLVGLGPEMVTVPMVNAAVREVDIRGIFRYCNTWPVAISLLASKRINVKPLVTHRFPLE
KALEAFETTKRGEGVKVMLKCDPTDQNP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacagttcagcagcaaagccaggaggtggcatccgagacctgagcacggggaacagc
aacagccggagcccgagcgcgattccagctcggacagtgcgggaaacaggagcaggtgga
ggctgggtggttgttgctcctttgggctgtcagagccaggaaaaccgtccaatcccagaa
ccaggtcctaatgaggtcctgctgcgcatgcattccgtggggatctgtggctctgacgtt
cactactggcagcacggtcgcatcggggattttgttgtcaaggatcccatggtgctggga
cacgaagcttccgggactgtcgtaaaagtgggctctggggtgactcatctgaagccaggt
gaccgtgtggccatcgagccaggtgtcccgagggagatggatgaattctgcaaatctggc
cgctacaacctgtccccaaccatcttcttctgcgcgacgccgcccgacgacggcaacctg
tgccgctactacaagcacagcgcaagctactgctacaagcttccagacaatgtcaccttt
gaggaaggagccctcatcgagcccctctcagtgggaatccacgcctgcaaaagagcagga
gtcactctgggaagcaaagtcttcgtgtctggctctggaccaattggcctcgttaatgtg
attgttgctaagatgatgggggcagcagctgtggtggttacagacttatctgcctctcgc
ctgcagaaagccaaggaggtgggggcagatttcaccatccaggtgaagaatgagaccccg
caggaggtggcctccaaagtggaaagtgtgcttggctgcatgcctgagataactgtggag
tgcacaggagtgcaagcctgtatccaggctggaatttatgccactcgttctggtgggacc
ctggttctggtggggctggggcctgagatggtgacggtgcccatggtgaacgccgccgtg
cgggaggtggacatccgtgggatattccgctactgcaacacgtggcctgtggccatctct
cttctggcatccaagcggatcaacgtcaagcccttggtcacgcaccgctttcccctggag
aaggctctggaggcctttgagaccaccaagaggggtgagggggtcaaagtgatgctgaag
tgtgaccccactgatcaaaacccctga

DBGET integrated database retrieval system