KEGG   Geospiza fortis (medium ground-finch): 102037337Help
Entry
102037337         CDS       T03755                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00020  Citrate cycle (TCA cycle)
gfr00190  Oxidative phosphorylation
gfr01100  Metabolic pathways
gfr01200  Carbon metabolism
Module
gfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gfr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102037337 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102037337 (SDHB)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102037337 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 102037337
NCBI-ProteinID: XP_014165484
LinkDB All DBs
Position
Un
AA seq 261 aa AA seqDB search
MAPLLRVLRQAQTAAAAPRLKKFAIYRWDPDKAGDKPRMQTYEVDLNKCGPMVLDALIKI
KNEMDSTLTFRRSCREGICGSCAMNIAGGNTLACIKKIDSDLSKVTKIYPLPHMYVVKDL
VPDLSNFYAQYKSIEPYLKKKDESKEGKQQYLQSIEDRQKLDGLYECILCACCSTSCPSY
WWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNP
GKAIAEIKKMMATYKQKAATA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctctcctgagggtgctccggcaggcgcagacggcggcggcggctccgcggctg
aagaaattcgccatctacagatgggaccccgacaaggccggggacaaaccccgcatgcag
acctacgaggtggacctgaacaagtgtgggcccatggtgctcgatgccctgatcaagatc
aagaacgagatggactccacgctgaccttccgcaggtcctgcagggaggggatctgcggc
tcctgcgccatgaacatcgccggcggcaacaccctggcctgcatcaaaaaaatcgacagc
gacctcagcaaagtcaccaaaatctacccgctgccccacatgtacgtggtgaaggacctg
gtgccggacctgagtaacttctatgcccagtacaaatccatcgagccctacctgaagaag
aaggacgagtccaaggagggcaagcagcagtacctgcagtccatagaggatcgccagaaa
ctggacgggctctacgagtgcatcctgtgtgcctgctgcagcaccagctgtcccagctac
tggtggaacggggacaagtacctgggccccgccgtgctcatgcaggcgtaccgctggatg
atcgattcccgggatgagttcaccgaggagcgcctggcgcagctgcaggacccgttctcg
ctgtaccgctgccacaccatcatgaactgcacccgcacctgccccaaggggctgaaccct
ggcaaggccatcgctgagatcaagaagatgatggcgacctacaagcagaaggcagcgact
gcctga

DBGET integrated database retrieval system