KEGG   Geospiza fortis (medium ground-finch): 102038455Help
Entry
102038455         CDS       T03755                                 

Gene name
ITGA2
Definition
(RefSeq) integrin subunit alpha 2
  KO
K06481  integrin alpha 2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04145  Phagosome
gfr04510  Focal adhesion
gfr04512  ECM-receptor interaction
gfr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102038455 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102038455 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102038455 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102038455 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gfr04147]
    102038455 (ITGA2)
   04515 Cell adhesion molecules [BR:gfr04515]
    102038455 (ITGA2)
   04090 CD molecules [BR:gfr04090]
    102038455 (ITGA2)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102038455 (ITGA2)
  Exosomal proteins of bladder cancer cells
   102038455 (ITGA2)
Cell adhesion molecules [BR:gfr04515]
 Integrins
  Integrin alpha subunits
   102038455 (ITGA2)
CD molecules [BR:gfr04090]
 Proteins
  102038455 (ITGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA VWA_2 FG-GAP VCBS FG-GAP_2 Integrin_alpha DUF4139 DUF4459
Motif
Other DBs
NCBI-GeneID: 102038455
NCBI-ProteinID: XP_005422087
LinkDB All DBs
Position
Un
AA seq 1229 aa AA seqDB search
MGKNYGRQVSNSAFFREAAASEVMGTELSFQLASEAVREEQGLKHAALKMVWWNGHWTHC
SPHALGCILHNCCEAYNVGLLEAKIFSGPPREQFGYAVQQFINEQGKWLLVGSPWSGYPA
NRTGDIYACPVGVSKTTCKKLNLQALINIPNVTEIKKDMNLGLTLIQNSKTGGFLTCGPL
WAQQCGRQYYATGVCSEISPSFEILRSFSPAVQKCSSVIDVVVVCDESNSIYPWDAVRAF
LKKFVQGLDIGLNKTQVGLIQYANDPRVVFNLNTYQTKDEVVKAMEKTSQKGGDLTNTFK
AIDYARQYAFSAESGGRPTATKVMVVVTDGESHDGSNLKTVIGKCNEDNITRFGIAVLGY
LIRHELDTKNLIKEIKGIASHPTEKYFFNVSSEAALLEEAGTLGERIFSIEGTDQGDTFQ
MEMSQVGFSAYYSQKKDVLLLGAVGAYDWSGTVVQESSDRATTFPSHVFEKILQDRNHSS
YLGYSVAVLSTVSSVYFVAGAPRSNYTGRVVVYNVDSDGNVAIVQSQRGEQIGSYFGSVV
CSVDVNRDSVTDVLLVGAPMFMNDLKKEEGRVYMFSITKRILDQQELLEGPQGSENARFG
SAIAALADIDLDGSNDVVIGAPLENQNSGAIYIYNGFQKTIRTKYSQKILGSDSAFGQKL
QFFGRSVDGHRDLDDDGITDVSVGADGNVVVLWSRGIANVSITASFKPEKISLLNKNTDI
TVKICFQASFRPAKKNNQVAIKYNATLDADLQSSRVTSRGFFKENNERYMQRDLVVHNEE
NCVHDVFSVQEPSDAVNSLSLRIDIGLANPGSSPVLDISSPASVAYSIPFIKDCGEDELC
ICDLVLNVQQKADDGKQQFIVSSKNRRLTFNVKLRNKKENAYNTRIQATFSDNLFFASSS
LPSDGTEVSCQTGTAQSTVICQISYPVFRTGQQVSFDISFDFNLKNLQNVAVLSFRAWSE
SKEQQDSDNQVTLSIPLRYDAEIHFTRLANINFYEVYSGRNIPSTVNNFEDIGPTFNFSV
KVTTGSIPVKMASVTINLPELTSKGNPLMYLTAVTTDEVRGVTCNAQINPLQIGKRPYSP
SFTKENFRASKELNCQNVKCSTITCKLEHIALKGEYFVNVSTQIWNGTFAALIFQTLQLS
AEAKIDTNNPELFIIGENTLTIPVTIMKPDEKAEVPVGVVIGSILAGLLLLLVLVAVLWK
LGFFKRQYEKMTQDIEDVDEIAELTKDKD
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaattatgggagacaagtgtccaattcagctttctttcgagaggcagctgct
tcagaagtaatgggtacagagctaagcttccagttagcttcagaagctgtgagggaggaa
cagggtcttaaacatgctgccctaaaaatggtatggtggaatggtcactggacccactgc
agtcctcacgctttaggctgcattcttcataactgctgtgaagcctacaatgttgggctc
ctggaagcaaaaatattttctggtccaccaagagagcagtttggatacgcagttcaacag
tttataaatgaacaaggcaaatggttgttggttggttcaccctggagtggctatcctgcg
aacagaactggagatatatatgcatgtcctgttggtgtctccaaaaccacatgcaaaaaa
ttgaatttacaagctttaataaatattccaaatgtgactgaaattaagaaggacatgaac
cttggcttgactctgatacagaactcaaaaactggaggatttctgacttgtggtcccttg
tgggcgcagcagtgtggaagacaatactatgcaacaggagtttgttctgaaatcagtcca
agttttgagatcttaagaagcttttctccagctgttcaaaagtgttcctctgttatagat
gttgtggtggtttgtgatgagtcaaacagcatttatccctgggatgcagtgcgggcattt
ttgaaaaaatttgtacaaggcttagacataggccttaacaagacccaggtgggtttaatt
cagtatgctaatgatccccgagtagtcttcaacttgaatacgtatcaaaccaaggatgag
gttgttaaagcaatggagaaaacgtctcagaagggaggagatctcactaatactttcaaa
gccattgactatgcaagacagtatgccttctcagctgagtcgggaggacgcccgacagcc
acaaaagtcatggttgttgtgacagacggcgaatcacatgatggctccaacctgaaaaca
gtgataggtaaatgcaatgaagacaatataaccagatttggcattgctgttttgggatac
ttaataaggcatgaacttgatactaaaaacttaattaaagaaatcaagggaattgctagt
cacccaacagaaaagtatttcttcaatgtgtcatctgaggctgcactactggaagaagca
ggaacacttggagaacgcatttttagtatagaaggcactgatcaaggtgataccttccaa
atggaaatgtcacaggtgggcttcagtgcatattactcacaaaaaaaggatgttctgctg
ctgggtgcagttggggcctatgactggagtggaacagtagttcaggagtcttcagacaga
gccaccacctttccaagccatgtgtttgagaagattctacaggatagaaatcatagctca
tacctaggttactctgttgctgttctctcaactgtgagctctgtctattttgttgctggt
gcaccaagatccaactacactggcagagtggtggtttataacgttgacagtgatggtaat
gttgcaattgtgcagtcacagagaggcgagcagattggctcctactttggcagtgtggtg
tgttcagtagatgtcaacagggattctgtgacagatgtgctgcttgtgggtgcaccaatg
ttcatgaatgacctgaagaaagaagaagggagagtgtacatgttttccatcacaaagaga
atcttggatcaacaagaactcttggaaggtccacaggggtcagaaaatgcacgctttgga
tcagcaattgcagcacttgcagacattgatttggatggttctaatgatgttgtaataggg
gcaccactggaaaaccaaaactcgggagcaatttacatttataatggatttcaaaagact
atacgcaccaaatattctcagaaaatcttaggatcggattctgcttttggacaaaagctc
caattctttggaagatcagtagatggccatagagacttagatgacgatggcattactgac
gtatcagttggtgctgatggaaatgtggttgtgctatggtcaagaggcattgcaaatgtg
tccataactgcttcatttaaacctgaaaaaatcagtctgctgaacaagaacacagatata
actgtcaaaatatgttttcaggcttcatttagacctgctaagaaaaataatcaagtggct
ataaagtacaatgcaacattggatgcagatctccagtcctccagagtgacttctagagga
tttttcaaagaaaataatgaaaggtacatgcagagggatcttgtggtgcataatgaagag
aattgtgttcatgatgtcttcagtgtacaagagccttcagatgccgtgaattcacttagt
ttgcgcattgacattggccttgcaaatcctggctccagccctgtcctggacatatcttct
ccagcatctgtggcctatagtattccttttattaaagactgtggtgaagatgaactttgt
atctgtgatcttgttctgaatgttcagcagaaggcagatgacggcaaacaacagttcatt
gtcagcagcaaaaacagaagactaacattcaacgtgaaattgagaaataagaaggaaaat
gcatataacaccagaatccaggctacattttcagacaacttgttttttgcttcatcttct
ttaccgagcgatgggactgaagtctcatgtcaaacaggaacagcacaaagtacagtcatt
tgccaaataagctatcctgttttcagaacaggacaacaggtatcctttgatattagcttt
gatttcaacctcaaaaatcttcagaatgtggcagttctaagttttcgtgcatggagtgaa
agtaaggaacagcaagactcggacaaccaggtcaccttatcaattcctttgcgatatgat
gcagaaattcacttcacaaggcttgccaatatcaacttttatgaagtatactctggtcgt
aacattccttccactgtgaataattttgaagatattggccccacgttcaacttctcagtt
aaggtaacaacaggaagtattccagtaaagatggcatctgtaacaatcaatcttcccgaa
ctgaccagcaaaggcaacccactgatgtacctaactgcagtcaccacagatgaggtcaga
ggtgttacttgcaatgctcagataaatccactgcaaataggaaaaagaccttattctcca
tctttcacgaaagagaacttcagagcttccaaagaactgaactgtcagaacgtgaaatgc
agtaccatcacatgcaagctggaacacattgcactgaagggagagtactttgtgaacgtg
tccacccaaatctggaacggaacctttgctgccttaattttccagacattacaactctct
gcagaagcaaaaattgatacaaataaccctgagttatttatcattggagagaatacccta
actatcccagttacaataatgaagccagatgagaaagctgaggtaccagtaggtgttgtg
attggcagcatattggctggactcctcttgctgttggtactggttgctgttttgtggaag
cttggcttcttcaagagacagtacgagaaaatgacacaggatatagaagatgtcgatgaa
attgcagaactcacaaaggacaaagattga

DBGET integrated database retrieval system